KEGG   Mus musculus (house mouse): 19378
Entry
19378             CDS       T01002                                 
Symbol
Aldh1a2, AV116159, Aldh1a7, Raldh1, Raldh2
Name
(RefSeq) aldehyde dehydrogenase family 1, subfamily A2
  KO
K07249  retinal dehydrogenase [EC:1.2.1.36]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00830  Retinol metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    19378 (Aldh1a2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.36  retinal dehydrogenase
     19378 (Aldh1a2)
SSDB
Motif
Pfam: Aldedh DUF1487 LuxC
Other DBs
NCBI-GeneID: 19378
NCBI-ProteinID: NP_033048
MGI: 107928
Ensembl: ENSMUSG00000013584
UniProt: Q62148
Position
9:71123071..71203525
AA seq 518 aa
MTSSEIAMPGEVKADPAALMASLQLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVCNP
ATGEQVCEVQEADKVDIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRATL
ATMESLNGGKPFLQAFYIDLQGVIKTLRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVC
GQIIPWNFPLLMFTWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVVNILP
GYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADAD
LDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVKRSVERAKRRIVGSPFDPTTEQG
PQIDKKQYNKVLELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFG
PVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALMVSSAMQAGTVWINCYNALNAQ
SPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS
NT seq 1557 nt   +upstreamnt  +downstreamnt
atgacttccagcgagatcgccatgccgggcgaggtgaaggccgaccccgccgcgctcatg
gcctcgctgcagctcctgccgtcgcccacgcccaacctcgagatcaagtacaccaagatc
tttattaacaatgaatggcagaactcagagagtgggagagtgttccctgtctgtaatcca
gccacaggagagcaagtgtgtgaagttcaagaagcagacaaggtggatatagacaaggca
gtgcaagcagcccgccttgccttctctcttggttctgtgtggagaaggatggatgcgtct
gaaagaggacgtctgttggacaagcttgcagacttggtggaacgggacagggcaactctt
gcaactatggaatccctaaatggcggtaagccattcctgcaagctttttacatcgatttg
cagggagtcatcaaaaccctgaggtattatgcaggctgggctgataaaattcacggaatg
accattcctgtagatggagactattttactttcacaagacacgagcccattggagtgtgt
ggacagatcatcccgtggaacttccccctgctgatgttcacctggaaaattgctcccgca
ttgtgctgtggtaacaccgtggtcatcaaacccgctgagcagacaccgctcagtgcactg
tatatgggagccctcatcaaggaggctggctttccacccggagtcgtcaatatcctgcca
gggtatgggccaacagcaggggcagcaatcgcttctcacatcggcatagacaagattgca
ttcacaggctctactgaggttggaaagcttattcaagaagcagctggaagaagtaacctg
aagagagtgaccctggaactcggagggaagagccctaatattatttttgcagatgctgac
ttggactacgctgtggagcaggctcaccagggtgtgttcttcaaccaaggccagtgctgc
accgcagggtctcgcatctttgtggaagaatccatctatgaggaatttgtgaaaagaagt
gtggaaagggccaagaggcgcattgtggggagcccctttgatcccacaactgagcagggt
cctcagatcgataagaaacaatacaacaaagtcctggagcttatccagagcggtgtggct
gagggcgccaagctggagtgcggaggcaaagggctgggaaggaagggcttcttcattgag
cccaccgtgttctccaacgtcactgatgacatgcggattgccaaggaggagatctttggt
cctgttcaagaaattttgaggtttaagactatggatgaagttatagaaagagccaataac
tcagactttggacttgtagcagctgtcttcactaatgacatcaacaaggctctcatggta
tcctccgcaatgcaagctgggacagtttggatcaattgttacaatgccttaaatgcgcag
agcccctttggggggttcaagatgtctggaaatgggagagaaatgggtgagtttggctta
cgggagtattcagaagtaaagaccgtgacggtgaagatcccccagaagaactcctaa

DBGET integrated database retrieval system