KEGG   Mus musculus (mouse): 19385Help
Entry
19385             CDS       T01002                                 

Gene name
Ranbp1, Htf9a
Definition
(RefSeq) RAN binding protein 1
  KO
K15306  Ran-binding protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05166  Human T-cell leukemia virus 1 infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    19385 (Ranbp1)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    19385 (Ranbp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ran_BP1 WH1
Motif
Other DBs
NCBI-GeneID: 19385
NCBI-ProteinID: NP_035369
MGI: 96269
Ensembl: ENSMUSG00000005732
Vega: OTTMUSG00000026021
UniProt: P34022
Position
16 A3; 16 11.3 cM
AA seq 203 aa AA seqDB search
MAAAKDSHEDHDTSTENADESNHDPQFEPIVSLPEQEIKTLEEDEEELFKMRAKLFRFAS
ENDLPEWKERGTGDVKLLKHKEKGTIRLLMRRDKTLKICANHYITPMMELKPNAGSDRAW
VWNTHADFADECPKPELLAIRFLNAENAQKFKTKFEECRKEIEEREKKGPGKNDNAEKVA
EKLEALSVREAREEAEEKSEEKQ
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgccaaggacagtcacgaggaccatgatacttccacagagaatgcagatgag
tccaaccacgacccccagttcgagccaatagtttctcttcccgagcaagaaattaaaacg
ctggaggaagatgaagaggaactttttaagatgcgtgcaaagctgttccggtttgcttca
gagaatgacctcccagaatggaaggagcgaggcactggagatgtcaagcttctgaagcac
aaggagaaagggaccatccgccttcttatgaggagggacaaaaccttgaagatatgcgcc
aaccactatattacaccaatgatggagctgaagccgaatgctggcagtgaccgagcctgg
gtctggaatacccacgccgactttgctgacgagtgccccaagcctgagctgctcgccatc
cgcttcctaaatgctgagaatgcacaaaagttcaaaacaaagtttgaagaatgcaggaaa
gaaattgaagagagagaaaagaaaggaccaggcaaaaatgataatgccgaaaaggtggcc
gagaagctggaagccctttcagtgagggaggccagagaggaggctgaagagaagtctgag
gagaaacaatga

DBGET integrated database retrieval system