KEGG   Mus musculus (mouse): 19411Help
Entry
19411             CDS       T01002                                 

Gene name
Rarg, Nr1b3, RAR-gamma, RARD, RARgamma2
Definition
(RefSeq) retinoic acid receptor, gamma
  KO
K08529  retinoic acid receptor gamma
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    19411 (Rarg)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mmu03310]
    19411 (Rarg)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone-like
    19411 (Rarg)
Nuclear receptors [BR:mmu03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   19411 (Rarg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 19411
NCBI-ProteinID: NP_035374
MGI: 97858
Ensembl: ENSMUSG00000001288
Vega: OTTMUSG00000029220
UniProt: P18911
Position
15 F3; 15 57.4 cM
AA seq 458 aa AA seqDB search
MATNKERLFAPGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMAS
LSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQK
NMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSY
ELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIK
IVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMH
NAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEA
LRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPE
MFEDDSSKPGPHPKASSEDEAPGGQGKRGQSPQPDQGP
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaataaggagagactctttgcgcccggtgccctggggcctggatctggttac
ccaggagcaggcttcccattcgccttcccaggtgcactcagagggtcgccaccatttgag
atgctgagccctagcttccggggcctgggccagcctgacctccccaaggagatggcttct
ctctcggtggagacacagagcaccagctcggaggagatggtacccagctctccctcaccc
ccaccacctcctcgggtctataagccatgctttgtatgcaatgacaagtcttctggctac
cactatggggtcagctcctgtgaaggctgcaagggcttcttcagacgcagcattcagaaa
aacatggtgtatacatgtcaccgtgacaaaaactgtatcatcaacaaggtcaccagaaat
cgatgccagtactgcaggctacaaaagtgtttcgaagtgggcatgtccaaggaagctgta
aggaacgatcgaaacaagaagaaaaaggaggtaaaagaggagggctcgcccgacagctat
gaactgagtccacagttagaggaactcatcaccaaggtcagcaaagcccaccaggagact
tttccctcactctgccagctgggcaagtacaccacgaactccagtgcagatcaccgggtg
cagctggacctggggctgtgggacaagttcagcgagctggccaccaaatgcatcatcaag
attgtggagtttgcgaagcggctgcctggttttacagggctcagcattgccgaccagatc
acgctgctcaaggctgcttgtctggacatcctaatgctgcggatctgtacaaggtatacc
ccagagcaggacactatgacattctcggatgggctgaccctgaaccgaacccagatgcac
aatgctggctttgggccccttacagacctcgtctttgcctttgccgggcagctgctgccc
ctggagatggatgacaccgagactgggctacttagtgctatctgcctcatctgtggagac
cgaatggacctggaagagcccgagaaggtggacaagctgcaggagcccctgctggaagcc
ctgaggctctatgcccggcgacggagacccagccaaccctacatgttcccaaggatgctg
atgaaaatcaccgacctccggggcatcagcactaagggagcagaaagggctataaccctg
aagatggagattccaggcccgatgccacccctgatccgagagatgctggagaacccggag
atgtttgaggacgactcctcgaagcctggcccccaccccaaggcttccagtgaggacgaa
gctccagggggccagggcaaaaggggccaaagtccccaacctgaccaggggccctga

DBGET integrated database retrieval system