KEGG   Mus musculus (mouse): 19417
Entry
19417             CDS       T01002                                 

Gene name
Rasgrf1, AI844718, CDC25, CDC25Mm, Gnrp, Grf, Grf1, Grfbe, Grfbeta, P190-A, Ras-GRF1, p190, p190RhoGEF
Definition
(RefSeq) RAS protein-specific guanine nucleotide-releasing factor 1
  KO
K04349  Ras-specific guanine nucleotide-releasing factor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    19417 (Rasgrf1)
   04014 Ras signaling pathway
    19417 (Rasgrf1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    19417 (Rasgrf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    19417 (Rasgrf1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   19417 (Rasgrf1)
SSDB
Motif
Pfam: RasGEF RhoGEF PH RasGEF_N PH_11 PH_13 IQ PH_17 AAA_11
Other DBs
NCBI-GeneID: 19417
NCBI-ProteinID: NP_035375
MGI: 99694
Ensembl: ENSMUSG00000032356
Vega: OTTMUSG00000046289
UniProt: P27671 B2RS27
Structure
PDB: 
2IJE

Position
9 E3.1; 9 47.31 cM
AA seq 1262 aa
MQKAIRLNDGHVVTLGLLAQKDGTRKGYLSKRSADNPKWQTKWFALLQNLLFYFESDSSP
RPSGLYLLEGSICKRAPSPKRGTSSKESGEKQQHYFTVNFSNDSQKTLELRTEDAKDCDE
WVAAIARASYKILATEHEALMQKYLHLLQVVETEKTVAKQLRQQLEDGEVEIERLKTEVT
ITNLIKDNDRIQSSNKAGSADDEDSDIKKIKKVQSFLRGWLCRRKWKNIIQDYIRSPHAD
SMRKRNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETI
MFLHQIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDF
DKLLKQYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKL
EELSRIMHDEVSETENIRKNLAIERMITEGCEILLDTSQTFVRQGSLMQMSLSEKSKSSR
GRLGSLSTKKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLLDEPENLDDEA
KGAGPEIEHLEFKIGVEPKDSLPFTVILVASTRQEKAAWTSDIIQCVDNIRCNGLMMNAF
EENSKVTVPQMIKSDASLYCDDVDIRFSKTMNSCKVLQIRYASVERLLERLTDLRFLSID
FLNTFLHSYRVFTNAMVVLDKLINIYRKPMSAIPARSLELLFSSSHNAKLLYGDAPKSPR
ASRKFSSPPPLAIGTSSPSRRRKLSLNIPIITGGKALELASLGCSSDSYANIHSPISPFG
KTTLDTGKLCMASSLPKTPEEIDVPATIPEKPGELSASRKHSSDVLKEESEDDQNHSDED
NTEVSPVKSPPTPKSFLNRTITEFPFFNYNNGILMTTCRDLVDNNRSTLSATSAFAIATA
GANEGPSNKEVFRRMSLANTGFSSDQRNIDKEFVIRRAATNRVLNVLRHWVTKHTQDFDT
DDTLKYRVICFLEEVMHDPDLLTQERKAAANIIRTLTLEETTEQHSMLEEVILMTEGVKT
EPFENHPALEIAEQLTLLDHLVFKSIPYEEFFGQGWMKAEKYERTPYIMKTTKHFNHVSN
FIASEIIRNEDISARASAIEKWVAVADICRCLHNYNAVLEITSSINRSAIFRLKKTWLKV
SKQTKSLLDKLQKLVSSDGRFKNLRESLRNCDPPCVPYLGMYLTDLVFIEEGTPNYTEDG
LVNFSKMRMISHIIREIRQFQQTTYKIDPQPKVIQYLLDESFMLDEESLYESSLLIEPKL
PT
NT seq 3789 nt   +upstreamnt  +downstreamnt
atgcagaaagccatccggcttaacgatggccacgtcgtgaccctgggactgctggcacag
aaggacggcacgcgcaaaggctacctgagcaagaggagtgcggacaacccaaaatggcaa
accaagtggtttgccctgctccagaacctgcttttctacttcgaaagcgactccagccct
cggccctcggggctctacctgctcgagggaagtatctgtaaacgcgcgccctcccccaag
cgagggacctcctccaaggagtccggcgagaaacagcaacattacttcacagtgaacttc
tccaatgacagccagaagaccttggagttgaggaccgaggatgccaaggactgtgacgag
tgggtggctgcgatcgctcgcgccagctacaagatactggctacagaacatgaggcgctt
atgcagaagtacttacacctgctgcaggtagtggagacagagaagactgtggctaagcag
ctgcgccagcagcttgaggacggtgaggttgagatcgagcgcctgaagacggaggtaact
attacaaacctgatcaaggacaatgatcgtatccaatccagcaacaaagccggttctgct
gatgatgaggacagtgacatcaagaaaattaagaaggttcagagcttccttcggggatgg
ctgtgccggcgaaagtggaagaacatcatccaggactacatccggtctccccacgcggac
agcatgcgcaagaggaaccaggtggtgttcagcatgctggaggccgaggctgagtacgtc
cagcagctacacatccttgtcaacaacttcctgcgcccactgcgcatggccgccagctct
aagaaaccccctataacacacgacgacgtcagcagtatctttctgaacagcgagaccatc
atgttcctgcatcagatcttctaccaaggcctgaaggcccgtatctccagctggcccacc
ctggtgctggcggacctgttcgatatcctgctgcccatgctgaacatctaccaggagttc
gtccgcaaccaccagtacagcctccagatccttgctcactgcaagcaaaaccgggacttt
gacaagctcctcaagcagtacgaggccaagccagactgcgaggagcgcacactggagacc
ttcctcacctacccaatgttccagatccccaggtacatcctgacactccatgagctgctg
gcccacacacctcatgagcatgtggagcgcaacagcctggactatgccaaatccaaacta
gaggaactgtccaggatcatgcatgacgaagtcagtgaaaccgagaacatccgcaaaaac
ctggccattgagcgtatgatcacggagggctgtgagatcctcctggacaccagccagacc
ttcgtgcgccaaggttccctcatgcagatgtccttgtctgaaaagagcaagtcctctagg
ggccgcctggggtctctgtccactaagaaagagggtgagcgccagtgtttcctattctcc
aagcatctcattatctgcaccagaggctctggtgggaaactgcacctaaccaagaatgga
gtcatatccctcattgactgcaccttactggatgaacccgaaaacctggacgacgaagcc
aaaggagccggaccagagatagaacacctggagtttaagatcggggtggagccaaaggac
tccctacccttcactgtcatcctggtagcctcaaccaggcaggagaaggcagcatggacc
agtgacatcatccagtgcgtggataatatccgctgcaatgggctcatgatgaatgccttt
gaagaaaattccaaggtcaccgtgcctcagatgatcaagtctgacgcttccttatattgt
gatgatgttgacattcgcttcagcaaaaccatgaattcttgcaaagtgcttcagatccgc
tatgccagcgtggagcgcctgctggagcgcctgactgatcttcgcttcctgagcattgac
tttctcaacaccttcctgcattcctatcgcgtcttcaccaatgctatggtggtcctggac
aagctgatcaatatctacagaaaacccatgagtgcgattcctgccaggtccctggaactc
ttgttttccagcagccacaacgccaagcttctgtacggagatgcccctaagtcccctcgc
gccagccgcaagttctcctcgccaccgcccttggccatcgggacgtcatcccccagccgc
cgtcggaagctgtccctcaacatccccatcatcacaggcggcaaggcgctggaactggct
tcccttgggtgcagctccgatagctacgccaacatacactcacccatatctcccttcggc
aaaaccacactggacactggcaagctctgtatggccagcagcttacccaagactccagag
gagattgatgtgcctgccacgattccagagaagcctggggagctctcagcctccaggaag
catagctctgatgtcctgaaagaagagtccgaggatgaccagaaccacagtgatgaagac
aacacagaagtgtcaccagttaaatccccaccaacaccaaaatcgttcttaaacagaacc
attacagagtttccattctttaactacaacaatggaatcctgatgaccacgtgtcgtgat
ctggtggacaataaccgcagcactctctcagctacttctgcctttgccatagcgactgca
ggagccaatgaaggcccctcaaacaaggaggtgtttcgaaggatgtctttggccaacaca
ggcttttcctctgaccagagaaatatcgacaaggagtttgtgatccgcagagctgccacc
aatcgtgtgctgaatgtgctccgccactgggtcaccaagcacacccaggactttgatacc
gacgatacgctcaaatacagggtgatctgtttcctggaggaggtcatgcatgacccagac
cttctgacccaagagcgaaaggcagcagccaacatcatcaggactctgaccctagaagaa
acaactgaacaacatagcatgctggaagaagtcatactgatgacggagggtgtgaagact
gagcccttcgaaaaccacccagccctggagatagcagagcagctgaccctgctggatcac
cttgtcttcaagagtattccttatgaagagttctttggccagggctggatgaaggccgag
aagtatgaaaggacaccttacattatgaaaaccaccaaacacttcaaccatgtcagtaac
ttcattgcttcagaaattatccgaaacgaggacatcagcgcaagggcaagcgccatcgag
aagtgggtggctgtggccgacatatgtcgctgcctgcacaactacaatgctgtgctggag
atcacctcctccatcaaccgcagcgccatcttccgtctcaaaaagacatggctcaaagtt
tctaagcagacgaaatctttgcttgacaagctccaaaagcttgtgtcatcagatggcaga
tttaagaacctcagagagtctttgagaaattgtgatccaccctgtgtcccttacctgggg
atgtatctcaccgacttggtgttcatcgaggaggggacacccaattacacagaggacggc
ctggtcaacttctccaagatgagaatgatctcccatattatccgagagattcgccagttt
cagcagactacctacaaaatcgacccccagccaaaggtaattcagtacttactggatgaa
tctttcatgttggacgaagaaagcctgtatgagtcttcgctcctaatcgaaccaaaactc
cccacatga

DBGET integrated database retrieval system