KEGG   Mus musculus (mouse): 19419Help
Entry
19419             CDS       T01002                                 

Gene name
Rasgrp1, Rasgrp, calDAG-GEFII
Definition
(RefSeq) RAS guanyl releasing protein 1
  KO
K04350  RAS guanyl-releasing protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04611  Platelet activation
mmu04660  T cell receptor signaling pathway
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    19419 (Rasgrp1)
   04010 MAPK signaling pathway
    19419 (Rasgrp1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    19419 (Rasgrp1)
   04660 T cell receptor signaling pathway
    19419 (Rasgrp1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    19419 (Rasgrp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF C1_1 EF-hand_6 EF-hand_1 RasGEF_N EF-hand_7 EF-hand_5 EF-hand_8 SPARC_Ca_bdg bZIP_1 DivIC
Motif
Other DBs
NCBI-GeneID: 19419
NCBI-ProteinID: NP_035376
MGI: 1314635
Ensembl: ENSMUSG00000027347
Vega: OTTMUSG00000015228
UniProt: Q9Z1S3
Position
2 E5; 2 59.19 cM
AA seq 795 aa AA seqDB search
MGTLGKAREAPRKPCHGSRAGPKARLEAKSTNSPLPAQPSLAQITQFRMMVSLGHLAKGA
SLDDLIDSCIQSFDADGNLCRNNQLLQVMLTMHRIIISSAELLQKVMNLYKDALEKNSPG
VCLKICYFVRYWITEFWIMFKMDASLTSTMEEFQDLVKANGEETHCHLIDTTQINSRDWS
RKLTQRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYLVNSCVKE
NPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIHVAQKLHQLQNFNTLMAVIGG
LCHSSISRLKETSSHVPHEINKVLGEMTELLSSCRNYDNYRRAYGECTHFKIPILGVHLK
DLISLYEAMPDYLEDGKVNVQKLLALYNHINELVQLQEMAPPLDANKDLVHLLTLSLDLY
YTEDEIYELSYAREPRNHRAPPLTPSKPPVVVDWASGVSPKPDPKTISKHVQRMVDSVFK
NYDLDQDGYISQEEFEKIAASFPFSFCVMDKDREGLISRDEITAYFMRASSIYSKLGLGF
PHNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKRIKSPAI
STENISSVVPMSTLCPLGTKDLLHAPEEGSFIFQNGEIVDHSEESKDRTIMLLGVSSQKI
SVRLKRTVAHKSTQTESFPWVGGETTPGHFVLSSPRKSAQGALYVHSPASPCPSPALVRK
RAFVKWENKESLIKPKPELHLRLRTYQELEQEINTLKADNDALKIQLKYAQKKIESLQLG
KSNHVLAQMDHGDSA
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgggaaccctgggcaaggcgagagaggctccgcggaaaccttgccatggctccagagct
ggccccaaagcaagactagaggccaaatcaaccaacagccctctccctgcccagcccagc
ttggcccagatcacccagttccgaatgatggtgtccctgggacatttggccaaaggagcc
agcctggatgatcttattgacagctgcattcaatcttttgatgcggatggaaacctgtgt
cggaataaccaactgttacaagtcatgctaaccatgcaccggatcatcatctcctcagcc
gagctgctacaaaaagtcatgaatctatataaggatgccctggaaaagaattctccagga
gtttgcctgaagatctgctattttgtcaggtattggataacagaattctggatcatgttc
aagatggatgccagcttgaccagcaccatggaagagttccaagacctggtgaaagccaat
ggtgaggagacccactgccacctcatcgacacgacccaaattaattctcgagactggtcc
aggaaactgactcagaggataaaatcgaatactagcaagaagcgcaaagtgtccctgctg
tttgaccatctggaacctgaagaactgtctgaacacctcacctaccttgagttcaagtcc
ttccgacggatatctttctctgattaccaaaattaccttgtaaatagctgcgtaaaagag
aaccccaccatggagaggtccattgccctgtgcaatggcatctcccagtgggtacaactg
atggttctcagccgtcccaccccgcagctccgggcagaggtcttcatcaagttcatccat
gtggctcagaaactccaccagctacagaacttcaacacgctgatggctgtgatcggggga
ctgtgtcacagctccatctccaggcttaaggaaacaagttcacatgtcccacatgagatc
aataaggttctgggcgagatgactgaactgctgtcctcctgcagaaactatgacaactac
aggcgagcctatggggagtgcacccacttcaaaatccccatactgggtgtgcacctcaag
gacctcatatccctgtatgaggctatgcccgactatctggaagatgggaaggtgaatgtc
caaaagctcctggccctttacaatcatatcaatgaattggtccagctgcaggagatggcc
ccaccattggatgccaacaaggacttggtgcatctgctgacgttatccctggatctatac
tatacagaagatgaaatctatgagctttcctatgcccgggagccgaggaaccacagagct
ccgccactgacaccttcgaagccaccagttgtagtagactgggcctctggagtgtctccc
aaacctgacccaaagaccatcagcaaacacgtccaaaggatggtggattctgtctttaag
aactatgatctcgaccaggatggctatatctctcaggaggagtttgagaagatcgctgca
agctttccattttccttctgtgtgatggacaaagatagggaaggcctcatcagcagagac
gagatcacggcctacttcatgagggccagctccatctattccaagctgggcctgggcttt
ccacacaactttcaagaaaccacttacctgaagcccaccttctgtgacaactgtgctggc
tttctctggggcgtgatcaagcaaggctatcgctgtaaagactgcgggatgaactgccac
aaacagtgcaaagacctggtggtgttcgagtgcaagaagcgaatcaagagcccagcaata
tccacagagaacatcagctctgtggtaccaatgtccaccctttgtccactgggaaccaaa
gatctgctccatgcacccgaagaaggatctttcattttccaaaacggagagattgtggac
cacagtgaggagagcaaggataggaccatcatgctcctcggagtgtcctcccagaaaatt
tcagttcggctgaagaggactgttgcccacaagagcacccaaacagaatcgttcccgtgg
gttggtggcgagacgacccctggtcactttgtgctgtcttctccaaggaagtcggcgcag
ggcgctctttatgtgcacagtccagcatctccatgccccagcccagcactggtccgaaag
cgggcattcgtcaagtgggagaacaaagagtcccttataaaaccaaaaccagaacttcac
ctccggctccggacctaccaagaactggaacaggaaataaataccctgaaagcagataac
gatgctctgaagatccaactgaagtacgcacagaagaaaatagaatccctgcagcttggg
aaaagcaatcatgtcttagcccagatggaccacggtgatagtgcttaa

DBGET integrated database retrieval system