KEGG   Mus musculus (mouse): 194231Help
Entry
194231            CDS       T01002                                 

Gene name
Cnksr1, BC037758
Definition
(RefSeq) connector enhancer of kinase suppressor of Ras 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: CRIC_ras_sig PH PDZ_6 SAM_1 PDZ PH_9 SAM_2 PH_13 RXLR
Motif
Other DBs
NCBI-GeneID: 194231
NCBI-ProteinID: NP_001074516
MGI: 2670958
Ensembl: ENSMUSG00000028841
Vega: OTTMUSG00000010566
UniProt: A2A9K7
Position
4; 4 D3
AA seq 700 aa AA seqDB search
MEPVEAWTPGKVAAWLRGLDDALQDYPFEDWQLPGKYLLQLCPQSLEALTVWPLGHQELI
LDGVEQLRALGSNLQTENLQSLAQGLLERTQAFQSLVQGSLGNCAETPADVLKAAVELVR
EAHALLSWLNGYLFSHLNDFSACQEIGVLCGELGQVLQEDCPEAEKERNILRICSHVAGI
CHNILSCSPEELLEQKAVLESVQVDDPSGLEIHTTSNCLHFVSRVGVQAATSSQILPGDE
IVQVNEQVVVGWSHKNMLRELLREPAKVSLVLKKIPVPETPSQTSLDSPHLLSQSLPLNP
PSPRVPSEGLLADGTPGPSPAWTDSTSFDAQSPPTPPGPPGVLPEETAEPLESSGHPDKS
PILGRKKSKGIATRLSRRRVSCRELGLPDCDGWLLLRKVPGGFMGPRWRRCWFVLKGHTL
YWYRQPQDEKAEGLINLSNYSLESGHDQKKKYVFQLTHDVYKPFIFAAETLSDLSKWVRH
LITCISKYQAQGRAPSSAREEDCYSETEAEDPDEEAGSRSASPGPAQAWSDTSPVASPLQ
SPRTSFNSSPDSSDRALEGMVQGLRQGGVSLLGQPQPLTHEQWRSSFMRRNRDPHLNERA
HRIRALQSTLKAKLQELQALEEVLGDPELTSAKFRQWKEQNQELYSEGLRTWGGTWAQTS
SSDPNSDSRAHSPQPLPFDPEEPSQLFPLTPENSRQPPDL
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggagcccgtggaggcctggacccccgggaaggtggcagcttggctgagaggccttgat
gatgccctacaggactatcccttcgaggactggcagctgcctgggaagtacctgctgcag
ctctgtccccaaagcctcgaggctctgactgtgtggcctttgggccaccaggaactcatt
ctagatggggtggaacagctccgggccctgggctctaatctacagacagagaacctgcag
agcctggctcaggggctgctggaaaggacccaggccttccaaagcttggtccaaggctct
ctgggcaactgtgctgagacaccggctgacgtcctcaaggctgcggtggagctggtgcgg
gaagcccatgccctcctctcttggctcaacgggtacctcttctctcacttaaatgacttc
tctgcctgccaggagattggcgtgctgtgcggggagctgggccaagtcctgcaggaggac
tgcccagaggctgagaaggaacgaaacatcctaaggatttgcagccacgtggctgggatc
tgtcacaacatcctgagctgcagcccagaggagctgctggaacagaaggccgtgctggag
tcggtgcaggtggacgacccttccggtctagaaattcacaccaccagcaactgcctgcac
tttgtgtcccgagtaggggttcaggctgccaccagctcccagatcctgccaggagacgag
attgtccaggtcaatgagcaggtggtggtgggctggtcccataagaacatgctgagggag
ctgctgagggaaccagcaaaggtcagcctggtactgaagaagattcccgtgccagagacc
ccctcacagacgtccctggactctcctcacctgctaagccaatcgctgcccctgaaccca
ccgtctcccagggttccgtctgaaggtcttttagcagatggaactcctggacccagccct
gcttggacagactctacctcctttgacgctcagtccccgcccactccccctggaccacca
ggcgtacttccagaagaaacagcagaacctctggagtcttcgggacaccctgacaagagt
cccatccttggtcggaagaaatctaaaggtatagccacgaggctgagccgccgccgggtg
tcctgccgagagttgggtctgccggattgtgatggatggcttctactgcggaaggtaccc
ggtggctttatgggcccacgctggcgccgctgctggtttgtgctcaagggacacacccta
tactggtaccgccaaccccaggatgaaaaggccgaagggcttatcaatctctccaactac
agcctagagagtggacatgaccagaagaaaaaatatgtgttccagctgacccatgatgtg
tacaagcccttcatctttgctgccgagaccctgtctgatctgagcaagtgggtgcgacat
ctcattacctgcatttccaagtaccaggctcaaggccgggccccctcctctgccagagag
gaagactgctacagtgagacagaagcagaagaccccgatgaggaggctgggtcccgctcc
gcttctcctggcccagctcaagcgtggagtgacacatcacccgtggcttcacccctgcag
agtccgagaacttcctttaactcttcaccagacagcagtgacagagccctggaaggaatg
gtacaggggctgaggcagggaggggtgtccctcctgggccagccccagcccctgacccat
gaacaatggcggagttctttcatgaggcgcaaccgtgaccctcatctcaatgagcgtgca
caccgtatccgggcactccagagcaccctcaaggcaaagctgcaggaactgcaggccctg
gaggaagtgctgggtgatcctgaactcacaagtgcaaagttccgacagtggaaggaacag
aaccaggagctatactcagagggcctgagaacctggggagggacgtgggcccagaccagc
tcctcagacccaaactctgactccagggctcattccccacagcccctcccctttgaccct
gaagagccctcccagctttttcccttaaccccagagaacagccgccaacctcctgacctc
tga

DBGET integrated database retrieval system