KEGG   Mus musculus (house mouse): 194268
Entry
194268            CDS       T01002                                 
Symbol
9930104L06Rik, C1orf109
Name
(RefSeq) RIKEN cDNA 9930104L06 gene
  KO
K26053  ribosome biogenesis protein C1orf109
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    194268 (9930104L06Rik)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    194268 (9930104L06Rik)
SSDB
Motif
Pfam: CK2S FAA_hydro_N_2 DUF6683
Other DBs
NCBI-GeneID: 194268
NCBI-ProteinID: NP_808241
MGI: 3041172
Ensembl: ENSMUSG00000044730
UniProt: Q499E6
Position
4:124830777..124838454
AA seq 217 aa
MAHDQPLLVVQEALRKCFPVVEEQQNLWQSTLQDCSPLLSSLSNLAEQLQAAQSLRFEDV
PALRPFPDLQERLRRKQLEAGDVVLDKLAERLATLLKVRNTINSHVEQVFQAYEQHAAVL
DIDTVLRPSVVSPSVADMLEWLQDIDRHYGSSYLKRKYLLSSIHWGDLASIQALPKAWDQ
ISENECQTLVSDVLVSVSFFLEEPGGCAASGDLEHHS
NT seq 654 nt   +upstreamnt  +downstreamnt
atggctcatgaccagcctctgctggttgtgcaggaggccctgaggaagtgcttccctgtg
gtggaggaacagcagaacctgtggcagagcaccctgcaggactgctcgcccctcctgtcc
tctctcagtaacctggctgagcagctgcaagccgcacagagtctgcgctttgaggatgtg
ccagccctgcgtccctttccagacttacaggagcggttgaggcgcaagcagctggaggct
ggtgacgttgttctggacaagctagctgagcggctagccaccctcctcaaggtccgtaac
accatcaacagccacgtggagcaggtgtttcaggcctacgagcagcatgcggctgtgcta
gacattgacaccgtcctgcgcccctcagttgtgagcccctctgtggctgacatgttggag
tggctgcaggacatcgacagacattatggaagctcgtacctgaagagaaagtacctcctc
tcctccatccactggggagacttggccagcatccaagcactgcccaaggcctgggaccag
atttcagaaaatgagtgccaaactcttgtgtcagatgtcctggtgagtgtctccttcttc
ctggaggagccaggaggctgtgcagcgtctggagatctggagcaccacagctga

DBGET integrated database retrieval system