KEGG   Mus musculus (mouse): 194952
Entry
194952            CDS       T01002                                 

Gene name
Jmjd4, 6430559I23
Definition
(RefSeq) jumonji domain containing 4
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Cupin_8 JmjC Cupin_4
Other DBs
NCBI-GeneID: 194952
NCBI-ProteinID: NP_848774
MGI: 2144404
Ensembl: ENSMUSG00000036819
Vega: OTTMUSG00000005800
UniProt: Q8BFT6
Position
11; 11 B1.3
AA seq 427 aa
MDRETRTFAERYYRDLRDPVPSGGGGPTPSGVTFIQTPNAFSYADFVKGFLLPNLPCVFS
SAFTEGWGSRRRWVTSEGKPDFEYLQQKYGDAVVPVANCGVREYNSNPKEHMSFRDYISY
WKDYIQGSYSSSRGCLYLKDWHLCRDSLVNDLEDIFTLPVYFSSDWLNEFWDVLNVDDYR
FVYAGPRGTWSPFHADIFRSFSWSVNICGKKKWLFFPPGEEEALRDCHGNLPYDVTSTEL
LDTHLYPKIQHHSLPIEVIQEPGEMVFVPSGWHHQVYNLDDTISINHNWVNGCNLPNMWH
FLQQELQAVQHEVEEWKDSMPDWHHHCQVIMKSCTGINFEEFYHFLKVIAEKRLLVLEQG
LKGDSGDSRSLDLGLQQAAFDIGRLADVLASVVVNPDFQRVDTSAFSPQPEELLQQLEDA
VAAAEAL
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggatcgggagacacgcacctttgccgagcggtactaccgggacctccgagacccagtc
cctagcggcggtggcggccccacacccagcggcgtgaccttcattcagaccccgaacgcc
ttctcctatgctgacttcgtgaagggcttcctgctgcctaacctgccctgcgtgttttct
agcgccttcaccgagggctggggcagcaggcggcgctgggtgacctcggagggaaagcct
gacttcgagtatctgcagcagaagtatggagacgcggttgtaccggttgccaactgtgga
gtgcgagaatacaattcaaaccccaaggagcacatgtccttccgcgactatatcagttac
tggaaggactacatccaagggagttactcctcttcgcggggctgcctctacctcaaggac
tggcatctgtgcagagactccttggtgaatgacttggaagacatattcaccctgcccgtg
tacttctcgtcagactggctgaatgagttctgggacgtcctcaatgtggatgactatcgt
tttgtctatgcaggccccaggggcacctggtctcccttccatgcagacatcttccgctcc
ttcagctggtcagtcaacatctgtgggaagaagaaatggttgttcttcccgccaggcgag
gaggaagccctccgggactgccatggtaacctgccctatgatgtgacttccactgagctc
ctggacacccacctgtatcccaagatccagcaccacagccttcccattgaagtcatacag
gagcctggtgagatggtgtttgtgcccagcgggtggcaccatcaagtgtacaacctggat
gacaccatttctattaaccacaactgggtcaatggctgcaacctgccaaacatgtggcac
ttcctgcagcaagagctccaggctgtgcagcatgaggtcgaagaatggaaggactccatg
cctgactggcaccaccactgccaggtcatcatgaagtcctgcacagggatcaattttgaa
gaattttaccatttcctcaaagtcatcgccgagaagaggctccttgtcctggagcaagga
ctgaagggggattcaggggacagccggagcctagacctgggcctacagcaggctgcattt
gatattggccgccttgcagatgtgctggcctctgtggttgtgaatcctgactttcagaga
gtggacaccagcgcattctcaccacagccagaagagttgcttcagcagctggaggacgca
gtggctgctgcagaggccctttag

DBGET integrated database retrieval system