KEGG   Mus musculus (mouse): 195208
Entry
195208            CDS       T01002                                 

Symbol
Dcdc2a, AW492955, Dcdc2, RU2
Name
(RefSeq) doublecortin domain containing 2a
  KO
K23405  doublecortin domain-containing protein 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    195208 (Dcdc2a)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    195208 (Dcdc2a)
SSDB
Motif
Pfam: DCX
Other DBs
NCBI-GeneID: 195208
NCBI-ProteinID: NP_808245
MGI: 2652818
Ensembl: ENSMUSG00000035910
Vega: OTTMUSG00000000615
UniProt: Q5DU00 R4GML1
Position
13:25239126..25394689
AA seq 475 aa
MNGPSSRSSHLSQPVVKSVLVYRNGDPFFAGRRVVIHEKKVSSFDVFLKEVTGGVQAPFG
AVRNIYTPRTGHRIRKLDQIESGGNYVAGGPEAFKKLNYLDIGEIKKRPMEAVNTEVKPV
IHSRINVSARFRKSLHEPCTIFLIANGDLISPASRLLIPKKALNQWDHVLQMVTEKITLR
SGAVHRLYTLEGKLVESGAELENGQFYVAVGRDKFKRLPYSELLFDKSAMRRPYGQKASS
LPPMVGSRKSKGSGNYRQSKSTIGSSDNSSPQPLKRKGKKDSNSEKPTKVKQSVKSKTSH
QAIPDNGEGIFKAGAERSETRGAAEVQEDEDTQVEVPVDQRPAEIVDEEEDGEKTSKDAN
QKEDFSAMNGETEDRGGSKAAGTSEQEEGIPDHGEKKASPSRVNGGTDEENGEELDQVAE
ELQSTEDEKGKAEGDNSGQDEAGLDAQRPPRPEVTVTSPQENEENEANKASSAVA
NT seq 1428 nt   +upstreamnt  +downstreamnt
atgaacggtcccagctccaggtccagccacctgtcgcagccggtggtgaagagtgtgctg
gtgtaccgcaatggggacccctttttcgccgggcggcgtgtcgtcattcacgagaagaag
gtgtccagcttcgatgtcttcctcaaagaagtgactggcggtgtgcaggcgccttttggg
gcggttaggaacatctacaccccgaggacgggccaccgcatccgaaaactggaccagata
gagagcgggggcaactatgtggctgggggcccggaagcgttcaagaaactcaattacttg
gacataggcgaaatcaagaaaagaccaatggaagctgtgaataccgaggtgaaacctgtc
attcacagcaggatcaacgtgtccgcccgcttcaggaagtcgctgcacgagccctgcacc
attttcttgattgcaaatggagacctcataagcccggcttctcgcctcctcatccctaaa
aaagctttaaatcagtgggatcatgtactacaaatggtcacagaaaagataactctccgg
agtggggctgtccacaggctatatacgttagaaggaaagctggttgagagtggagcagaa
ctggagaatgggcagttctatgtggccgtcggcagagataagtttaagagactaccgtac
agtgagttactttttgacaagtcagcaatgagaaggccttacggtcagaaagcgtcttca
ctacctcccatggttggatccaggaagtctaaagggagcggaaattatcggcaatccaag
tcaaccatcgggtctagtgataactcatctcctcagcctctgaaaaggaaagggaagaaa
gactcaaactcagaaaaacccacgaaagtgaaacagagtgtgaagtcgaagacttcccac
caagcaatcccagacaatggtgaaggcattttcaaagctggagcagagagatctgaaaca
aggggggcagcagaagttcaagaagatgaagacacccaggttgaggttccagtggaccag
aggccagcagaaatagttgatgaggaagaagatggtgagaaaacaagcaaagatgccaac
cagaaggaagacttttcagccatgaatggtgagactgaagacagaggggggagcaaagcg
gctggtacctctgagcaggaggagggaatcccagaccacggggagaagaaggcaagcccc
tctcgggtaaatggtggcacggatgaagagaatggggaggaactggaccaggttgccgag
gagctccaatcaacagaggacgagaaaggaaaggctgaaggagacaacagtgggcaagat
gaggctggtttggatgctcaaagaccaccaagaccagaagtgacagtcaccagccctcaa
gagaatgaagagaacgaagcaaacaaggcctcttctgctgtggcatag

DBGET integrated database retrieval system