KEGG   Mus musculus (mouse): 195434
Entry
195434            CDS       T01002                                 

Symbol
Utp14b, 4932411L21Rik, js, jsd
Name
(RefSeq) UTP14B small subunit processome component
  KO
K14567  U3 small nucleolar RNA-associated protein 14
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    195434 (Utp14b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    195434 (Utp14b)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  90S particles
   U3 small nucleolar RNA-associated proteins
    195434 (Utp14b)
SSDB
Motif
Pfam: Utp14
Other DBs
NCBI-GeneID: 195434
NCBI-ProteinID: NP_001001981
MGI: 2445092
Ensembl: ENSMUSG00000079470
Vega: OTTMUSG00000033117
UniProt: Q6EJB6 E9Q9S3
Position
1 C4; 1 40.84 cM
AA seq 780 aa
MKPKMRPDPSSRANRPCEKKEAATMNMARNVTDLLALSQQEELVDLPENYPLSTSEDEGD
SDGEGKRQKLLEAVSSLGRKNKWKLAERSEASRMVSEFNVTSEGSGEKLVLSDLLGSATA
LSSVAAVKKQLHRVKSKTLTPPLNKEEADRALREAAFSKTSQMLSRWDPVVLKNRQAEQL
IFPMEKEPPAVAPIEHVFTDWKVRTPLEREVFNLLHKNKQPVTDPLLTPVETASIRAMSL
EEAKIRRAELQRTRALQSYYEARARREKRIKSKKYHRALKKGKAKKALKEFEELWKDCPN
AALQELEKMEKARMTERMSLKHQGSGKWAKSKAIMAKYDPEARKAMQEQLAKNRELTQKL
QVVSESEEEDGCTEEGIVSVSHGMDDLQMNADGVNPWMLSSCNSNAKRGEIKTDPEQMPE
FVAHVSSESEGDERPVAEELVLKERSFQERVDPNNAKLMDGQETEDSDSQEVLQKLNKES
HQSDNQKVSSEENVLHIQREDLASEKLLVLQRLERAHVLEQQGELSKEEHYPKKGLSRPL
LKGDWKEMKPLTNPDASGGKKKKEQMIDLRNLLTANSSPVRSLAVPTIQQLEDEVETDHK
QLIREAFAGDDVIREFLKEKREAIETNKPKDLDLSLPGWGEWVGMGLKPSAKKRRRFLIK
APESSPRKDKNLPNVIISEKRNIHAAAHQVRALPHPFTHQQQFERTIQNPIGYMWNTQRT
FQKLTVPKVGTKLGHIIKPIKAENVGYCSSTRSDLSILQSSQKCLSRKQQKQLKKLSSAD
NT seq 2343 nt   +upstreamnt  +downstreamnt
atgaagccaaagatgagaccagatccttcttcaagagctaacaggccctgtgagaagaag
gaggctgctaccatgaacatggccaggaatgtgacagaccttctggctttgagccagcag
gaagaactagtggatttgccagaaaactatccactgagtacgagtgaagatgagggggac
agtgatggagaaggaaaacgtcaaaaacttctggaagcagtcagttcccttggtagaaag
aataaatggaagttggcagagagatctgaggctagtcggatggtttcagagttcaatgtc
acttctgaaggatcaggtgaaaagctggtcctttccgatttgcttgggtctgctacagca
ttatcttcggtggctgctgtgaaaaaacagctgcatagagtcaagtcaaagacgctcacc
ccaccccttaacaaagaagaggctgaccgagccctcagggaagcagcattcagcaaaacc
tcacaaatgctctccaggtgggatccggtggttctgaagaaccggcaggcagagcagttg
atttttcccatggagaaggagccgccagcggttgcacccattgaacatgtttttactgac
tggaaagtaagaacccctctggaacgagaagtttttaaccttcttcataagaacaagcag
ccagtaacagaccctttattgactcccgtggaaacagcctccatcagagccatgagcctg
gaagaagccaagatacgccgagcagagcttcagaggacgcgagctctacagtcctattat
gaggctagagctcgaagagagaagagaatcaagagtaagaagtatcacagagctctaaag
aaaggaaaggccaagaaagccttaaaagagtttgaagagctgtggaaagactgcccaaat
gctgcattgcaagaactggagaaaatggaaaaggccagaatgacagaacggatgagcctt
aagcaccagggcagtgggaaatgggcaaagtcaaaggcaattatggccaaatatgaccct
gaggctcgaaaagctatgcaagaacaattggctaagaacagagaactgacacagaaactc
caggtagtttcagagagtgaggaagaggacggatgcacagaagagggaatagtctctgtc
tcccatggaatggatgacctacagatgaatgcagatggtgtaaatccctggatgcttagc
agttgcaacagcaatgcaaagcggggtgagatcaagaccgatcctgaacagatgcctgag
tttgtggcccatgtgtcttctgagagtgagggagatgaaagaccagtggcagaagaactt
gtgttaaaagaaagatcctttcaagaaagagttgatcccaacaatgctaagctaatggat
ggccaagaaacagaagactctgatagccaggaggtattacagaaactcaacaaggaaagt
catcaatctgacaatcaaaaagtgagttcagaggaaaatgttctccatatccagagagag
gaccttgcctcagagaagttgttggtgcttcaaaggctagagagagcacatgttctggaa
caacaaggagagttgagcaaagaagaacattatccaaaaaaagggctttccagacctttg
ttgaaaggggattggaaggagatgaagccactcaccaaccctgatgcctctggagggaag
aaaaagaaggaacaaatgattgatctacggaacctcctaactgctaactcatctcctgtg
aggtctttggctgtgcccacaatacagcagttagaagatgaagtggagaccgatcacaag
cagctaataagggaagcttttgctggggatgatgtcataagagagttcttaaaagagaag
agggaagctatagagacaaataaaccaaaggacttggacctgtcattgcctggatggggt
gagtgggttggtatgggcctgaagcccagcgccaagaaaagacgccgttttcttattaaa
gctcctgagagttctccaagaaaagacaagaatttgccgaatgtgattatcagtgagaag
cgcaacatccatgcagctgctcatcaggtgcgggcgcttccacacccattcacccaccag
cagcagtttgaaaggactatccaaaaccctattgggtacatgtggaacacccagaggacc
ttccaaaagctgacagttcccaaggttggcaccaagctaggccatatcattaagcccata
aaagcagaaaatgtagggtactgctcttccacaaggtctgacctctctatcctacagagc
agtcagaagtgcctctccagaaaacagcaaaaacaactgaagaagttgagctctgcagat
tga

DBGET integrated database retrieval system