KEGG   Mus musculus (mouse): 19652Help
Entry
19652             CDS       T01002                                 

Gene name
Rbm3, 2600016C11Rik
Definition
(RefSeq) RNA binding motif (RNP1, RRM) protein 3
  KO
K13186  RNA-binding protein 3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    19652 (Rbm3)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    19652 (Rbm3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_7 Limkain-b1 RRM_occluded
Motif
Other DBs
NCBI-GeneID: 19652
NCBI-ProteinID: NP_001159882
MGI: 1099460
Ensembl: ENSMUSG00000031167
Vega: OTTMUSG00000018091
UniProt: O89086 Q545K5
Position
X A1.1; X 3.68 cM
AA seq 153 aa AA seqDB search
MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHA
SDAMRAMNGESLDGRQIRVDHAGKSARGSRGGAFGGRGRSYSRGGGDQGYGSGRYDSRPG
GYGYGYGRSRDYSGSQGGYDRYSGGNYRDNYDN
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctgaagaagggaaactcttcgtaggagggctcaacttcaacaccgatgaacag
gcacttgaagaccacttcagcagctttgggcctatctctgaggtggttgttgtcaaggac
cgggagactcaaagatcccggggttttggcttcatcaccttcacaaacccagagcatgcc
tcagatgcgatgagagctatgaatggagagtccctggatgggcgccaaatccgagttgat
catgcaggaaagtctgccaggggatccagagggggtgcctttggtgggcgtggtcgcagt
tactctagaggtggtggagaccagggatatggaagtggaagatatgacagtcgtcctgga
ggatatggatatgggtatgggcggtctagagactacagtggcagccagggtggctatgac
cgctactcaggaggaaattacagagacaattatgacaactga

DBGET integrated database retrieval system