KEGG   Mus musculus (mouse): 19664
Entry
19664             CDS       T01002                                 

Gene name
Rbpj, AI843960, CBF1, Igkjrb, Igkrsbp, RBP-J, RBP-J_kappa, RBP-Jkappa, RBPjk, Rbpsuh
Definition
(RefSeq) recombination signal binding protein for immunoglobulin kappa J region
  KO
K06053  recombining binding protein suppressor of hairless
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04330  Notch signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu05017  Spinocerebellar ataxia
mmu05165  Human papillomavirus infection
mmu05169  Epstein-Barr virus infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    19664 (Rbpj)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    19664 (Rbpj)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    19664 (Rbpj)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    19664 (Rbpj)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    19664 (Rbpj)
   05165 Human papillomavirus infection
    19664 (Rbpj)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    19664 (Rbpj)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Other transcription factors
   Others
    19664 (Rbpj)
SSDB
Motif
Pfam: BTD LAG1-DNAbind TIG RHD_dimer
Other DBs
NCBI-GeneID: 19664
NCBI-ProteinID: NP_033061
MGI: 96522
Ensembl: ENSMUSG00000039191
Vega: OTTMUSG00000054613
UniProt: P31266
Structure
PDB: 
3IAG 5EG6 3BRG 6DKS 4J2X

Position
5 C1; 5 29.37 cM
AA seq 526 aa
MPSGFPQSPRTSPRARPKTRITGALPMDYSEGLSAEERPAHAPSAGKFGERPPPKRLTRE
AMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSE
QESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIG
VFLSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRLRSQTVSTRYLHVEGGNFHASS
QQWGAFYIHLLDDDESEGEEFTVRDGYIHYGQTVKLVCSVTGMALPRLIIRKVDKQTALL
DADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPCPKEQNKEMINDGASWTIISTD
KAEYTFYEGMGPVLAPVTPVPVVESLQLNGGGDVAMLELTGQNFTPNLRVWFGDVEAETM
YRCGESMLCVVPDISAFREGWRWVRQPVQVPVTLVRNDGVIYSTSLTFTYTPEPGPRPHC
SAAGAILRANSSQVPSNESNTNSEGNYTNASTNSTSVTSSTATVVS
NT seq 1581 nt   +upstreamnt  +downstreamnt
atgccctccggttttcctcagtctccacgtacgtccccgagggcgcgtcccaaaacccgg
ataaccggagcgctccccatggactactcggagggcttgtccgcggaggagcggcctgcg
catgctccatcggcggggaagtttggtgagcggcctccacccaaacgactcactagggaa
gctatgcgaaattatttaaaagaacgaggggatcaaacagtgctcattcttcatgcaaaa
gttgcacagaagtcttacggaaatgaaaaacgatttttttgccctcctccttgtgtgtat
cttatgggcagtggttggaagaaaaaaaaagagcaaatggaacgagatggatgttctgaa
caagagtctcaaccctgtgcgtttattggaataggaaacagtgaccaagaaatgcagcag
ctgaacttggaagggaagaactactgtacagccaaaacattgtacatatctgattcagac
aagagaaaacatttcatgttgtctgtaaagatgttctatggcaacagcgatgacattggt
gtgttcctcagcaagcggataaaggtcatctccaaaccctccaaaaagaagcagtcactg
aagaatgctgacttgtgcattgcttcaggaacgaaggtggcactgttcaatcgccttcgg
tcccagacagttagtaccaggtacctgcatgtagaaggagggaatttccacgccagttca
caacagtggggagcattttacatccatctcttggacgacgacgagtcggaaggagaggag
ttcacagttagagatggctacatccattacgggcagactgtcaagcttgtgtgctcagtg
actggcatggcactcccaagattgataattaggaaagttgataagcagacggcattactg
gatgcagacgaccctgtatcacaactccacaaatgtgcattttaccttaaggatacagaa
agaatgtacttgtgcctttctcaagaaagaataatccaatttcaggccactccatgtcca
aaagaacaaaataaggaaatgataaacgatggagcttcctggacaatcattagcacagac
aaggccgagtacacgttctatgagggaatgggccccgtccttgccccagtcacccctgtg
cctgtcgtagaaagtcttcagttgaatggcggcggggacgtagcaatgcttgaacttaca
ggacaaaactttactccaaatttaagagtgtggtttggggatgtagaagccgaaacaatg
tacagatgtggagagagcatgctctgtgtggtcccagacatttctgcattccgggaaggt
tggagatgggtccgccagccagtccaggttccagtgactttggtccgaaatgacggggtc
atttactccaccagccttaccttcacctacacaccagagccagggccgaggccacactgc
agcgctgcaggagcgattctcagagccaactccagccaagtgccctccaatgagtcaaac
acaaacagcgaggggaattacacaaatgccagcacaaattctaccagtgtcacatcgtcc
acagcaaccgtggtgtcctaa

DBGET integrated database retrieval system