KEGG   Mus musculus (mouse): 19671
Entry
19671             CDS       T01002                                 

Gene name
Rce1, D19Ertd283e, D19Ertd98e
Definition
(RefSeq) Ras converting CAAX endopeptidase 1
  KO
K08658  prenyl protein peptidase [EC:3.4.22.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00900  Terpenoid backbone biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    19671 (Rce1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    19671 (Rce1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     19671 (Rce1)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M79: prenyl protease 2 family
   19671 (Rce1)
SSDB
Motif
Pfam: CPBP
Other DBs
NCBI-GeneID: 19671
NCBI-ProteinID: NP_075620
MGI: 1336895
Ensembl: ENSMUSG00000024889
UniProt: P57791
Position
19; 19 A
AA seq 329 aa
MAALGGDGLRLLSVSRPERQPESAALSGPGSGLCCWVSVFSCFSLACSYVGSLYVWKSEL
PRDHPAVIKRRSTSVLVVSSLSPLCVLLWRELTGIQPGTSLLTLMGFRLEGIFPAALLPL
LLTMILFLGPLMQLSMDCPCDLTDGLKVVLAPRSWARCLTDMRWLRNQVIAPLTEELVFR
ACMLPMLAPCTGLGPAVFTCPLFFGVAHFHHIIEQLRFRQSSVGSIFVSAAFQFSYTAVF
GAYTAFLFIRTGHLIGPVLCHSFCNYMGFPAVCAALEHPQKWPLLAGYALGVGLFLLLLQ
PLTDPKLYGSLPLCMLLERTGASETLLCS
NT seq 990 nt   +upstreamnt  +downstreamnt
atggcggcgctgggcggggacgggctgcgtttactgtcggtatcgcggccagagcggcag
cccgagtcagccgcgctgagcggcccgggctcggggctgtgctgctgggtgtctgtgttc
tcctgcttcagcctcgcctgctcctacgtgggcagcctctacgtgtggaagagcgagctg
cccagggaccaccccgctgttatcaagcggcgttccaccagtgtcctggtagtgtccagc
ttgtcccctctttgcgtgctgctctggagggaactcactggcatccagccaggcacatca
ctgcttaccttgatgggcttcaggctggagggcattttcccagcagcgctgctgcccctg
ctgctaactatgatccttttcctgggtccactgatgcagctctctatggattgcccttgt
gacctgacagatgggctgaaggttgtcctggcccctcgttcttgggcccgctgcctcaca
gacatgcgctggctacgaaaccaagttattgcaccgctgacagaggagctggtgttccgg
gcttgcatgctgcccatgctagcgccgtgcacgggtctgggccctgctgtgttcacctgc
ccactcttttttggagtcgcccattttcaccacattattgagcagctgcgcttccgccag
agcagtgtgggaagtatcttcgtgtctgcagcgttccagttctcctacaccgctgtcttc
ggtgcttatacagctttcctcttcatccgcacaggacacctgatagggccggttctctgc
cactctttctgcaactacatgggcttccctgcagtgtgtgcagccctggagcatccacag
aagtggccactgctggcaggctatgccctcggtgtgggacttttcctgcttctgcttcaa
cccctgacagaccccaagctctatggcagccttcctctttgtatgcttttggaaagaaca
ggggcctcagagaccctactgtgctcctga

DBGET integrated database retrieval system