KEGG   Mus musculus (house mouse): 19682
Entry
19682             CDS       T01002                                 
Symbol
Rdh5, 9-cis, AI987873, RDH4, cRDH
Name
(RefSeq) retinol dehydrogenase 5
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00830  Retinol metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    19682 (Rdh5)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     19682 (Rdh5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR DUF1776
Other DBs
NCBI-GeneID: 19682
NCBI-ProteinID: NP_598767
MGI: 1201412
Ensembl: ENSMUSG00000025350
UniProt: O55240
Position
10:complement(128749457..128755906)
AA seq 318 aa
MWLPLLLGALLWAVLWLLRDRQSLPASDAFIFITGCDSGFGRLLALQLDQKGFQVLAGCL
TPSGAEDLQQMASSRLHTTLLDITDPQNVQQVAKWVKTRVGETGLFGLVNNAGVAGIIGP
TPWLTQDDFQRVLSVNTLGPIGVTLALLPLLQQARGRVVNITSVLGRIAANGGGYCVSKF
GLEAFSDSLRRDMAPFGVQVSIVEPGFFRTPVTNLESLESTLKACWARLPPAIQAHYGEA
FLDTYLRVQRRIMNLICDPELTKVTSCLEHALTARHPRTRYSPGWDAKLLWLPASYLPAR
VVDAVLTWILPRPAQSVS
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtggctgcctctgcttctgggtgccttgctgtgggcagtgctgtggttgctcagagac
cggcagagcctgccggccagtgatgctttcatcttcatcactggctgtgactctggcttt
gggcgccttctggcactgcaacttgaccagaagggcttccaagtcctggccggctgcctg
accccctctggagcagaagacctgcagcagatggcctcctcccgcctccacacaacacta
ctggatatcactgatccccagaatgtccagcaagttgccaagtgggtgaagacacgtgtt
ggagaaactggactttttggtctggtgaataacgctggcgtagctggtatcatcgggccc
acaccatggctaacacaggatgatttccagagagtactgagtgtgaacacactggggccc
atcggtgtcacccttgccctgctgcccctgctacagcaggccaggggtcgggtggtcaac
atcaccagtgtcttgggccgcatagcagccaatggcgggggctactgtgtctccaagttt
ggcctggaggccttctctgacagcctgaggcgggacatggctccgttcggagtacaagtc
tccattgtggagcctggcttctttcgaacccctgtgaccaacctggagagtctggagagc
accctgaaggcttgttgggcccggctacctccagctatacaggcccactacggggaagcc
ttcctcgatacttatcttcgagtacagcgccgcatcatgaacctgatctgtgacccagaa
ctaacgaaggtgaccagctgcctggagcatgccctgactgctcgccacccccgaacacgc
tacagcccaggctgggatgccaagctgctctggctgcctgcctcctaccttccagccagg
gtggtggatgctgtgctcacctggatccttccccggcccgcccagtcagtctcctga

DBGET integrated database retrieval system