KEGG   Mus musculus (mouse): 19683Help
Entry
19683             CDS       T01002                                 

Gene name
Rdh16, CRAD, CRAD1, Rdh6
Definition
(RefSeq) retinol dehydrogenase 16
  KO
K11154  retinol dehydrogenase 16 [EC:1.1.1.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00830  Retinol metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    19683 (Rdh16)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     19683 (Rdh16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR
Motif
Other DBs
NCBI-GeneID: 19683
NCBI-ProteinID: NP_033066
MGI: 1201375
Ensembl: ENSMUSG00000069456
Vega: OTTMUSG00000027661
UniProt: O54909
Position
10; 10 D3
AA seq 317 aa AA seqDB search
MWLYLVALVGLWTLLRFFRVRQVVSHLQDKYVFITGCDSGFGTLLARQLDRRGMRVLAAC
LTEKGAEELRNKTSDRLETVILDVTKTESIVTATQWVKEHVGNRGLWGLVNNAGISTPSG
PNEWMKKQDFAHVLDVNLLGMIEVTLSMLPLVRKARGRVVNVSSVMGRVSLFGGGYCISK
YGVEAFSDSLRRELSYFGVKVAIIEPGFFLTGVTSSARLCSNTQMLWDQTSSEIREIYGE
KYLASYLKRLNKLDKRCNKDLSGVTDCMEHALTACHPRTRYSAGWDAKLFYLPLSYLPTF
LVDALLYWTSLKPEKAL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtggctctacctggtggcactggtgggcctgtggacgcttctgcgcttcttcagggtg
aggcaggtggtgagccatctccaagacaaatatgtcttcatcacgggctgtgactctggc
tttgggaccctgctggccagacagctggacaggagaggcatgagggtgctggctgcatgt
ctgacggagaagggagccgaggagctgaggaacaagacatctgacaggctggagacagtg
atcctggatgtcaccaagacagagagtattgtgacagccactcagtgggtgaaggagcat
gttgggaacagaggactctggggcctggtcaacaacgctggcatctccaccccctcgggt
cccaacgagtggatgaaaaagcaggactttgcacatgtactggatgtgaacctgttgggc
atgatcgaggtgactctgagcatgctgcctttagtgaggaaggcgaggggtcgtgtggtc
aacgtctccagtgtcatgggtcgagtgtctctctttggtggtggttactgcatctctaag
tatggtgtagaggccttctcagactccctcaggagggagctctcctactttggggtgaag
gtggctattatagagcctggcttcttcctgaccggtgtgaccagtagtgccagattatgc
tcaaatacccagatgctgtgggaccagaccagctcagaaatcagggagatctatggcgag
aagtacctggcatcctatctgaaaaggctaaacaaattggacaagaggtgcaacaaggac
ctgtctggggtgactgactgcatggagcatgctctgactgcctgtcaccctcgtacccga
tactcagctggctgggatgctaagctcttctacctccccttgagctacctgcccaccttt
cttgtggatgcccttctctactggacttccctgaagcctgaaaaagccctctga

DBGET integrated database retrieval system