KEGG   Mus musculus (mouse): 19697Help
Entry
19697             CDS       T01002                                 

Gene name
Rela, p65, p65_NF-kappa_B, p65_NFkB
Definition
(RefSeq) v-rel reticuloendotheliosis viral oncogene homolog A (avian)
  KO
K04735  transcription factor p65
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01523  Antifolate resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04064  NF-kappa B signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04137  Mitophagy - animal
mmu04151  PI3K-Akt signaling pathway
mmu04210  Apoptosis
mmu04211  Longevity regulating pathway
mmu04218  Cellular senescence
mmu04380  Osteoclast differentiation
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04668  TNF signaling pathway
mmu04722  Neurotrophin signaling pathway
mmu04917  Prolactin signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04926  Relaxin signaling pathway
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05030  Cocaine addiction
mmu05132  Salmonella infection
mmu05133  Pertussis
mmu05134  Legionellosis
mmu05135  Yersinia infection
mmu05140  Leishmaniasis
mmu05142  Chagas disease (American trypanosomiasis)
mmu05145  Toxoplasmosis
mmu05146  Amoebiasis
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05203  Viral carcinogenesis
mmu05212  Pancreatic cancer
mmu05215  Prostate cancer
mmu05220  Chronic myeloid leukemia
mmu05221  Acute myeloid leukemia
mmu05222  Small cell lung cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05321  Inflammatory bowel disease (IBD)
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    19697 (Rela)
   04010 MAPK signaling pathway
    19697 (Rela)
   04064 NF-kappa B signaling pathway
    19697 (Rela)
   04668 TNF signaling pathway
    19697 (Rela)
   04066 HIF-1 signaling pathway
    19697 (Rela)
   04071 Sphingolipid signaling pathway
    19697 (Rela)
   04024 cAMP signaling pathway
    19697 (Rela)
   04151 PI3K-Akt signaling pathway
    19697 (Rela)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    19697 (Rela)
  09143 Cell growth and death
   04210 Apoptosis
    19697 (Rela)
   04218 Cellular senescence
    19697 (Rela)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    19697 (Rela)
   04621 NOD-like receptor signaling pathway
    19697 (Rela)
   04622 RIG-I-like receptor signaling pathway
    19697 (Rela)
   04623 Cytosolic DNA-sensing pathway
    19697 (Rela)
   04625 C-type lectin receptor signaling pathway
    19697 (Rela)
   04660 T cell receptor signaling pathway
    19697 (Rela)
   04658 Th1 and Th2 cell differentiation
    19697 (Rela)
   04659 Th17 cell differentiation
    19697 (Rela)
   04657 IL-17 signaling pathway
    19697 (Rela)
   04662 B cell receptor signaling pathway
    19697 (Rela)
   04062 Chemokine signaling pathway
    19697 (Rela)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    19697 (Rela)
   04917 Prolactin signaling pathway
    19697 (Rela)
   04926 Relaxin signaling pathway
    19697 (Rela)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    19697 (Rela)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    19697 (Rela)
  09149 Aging
   04211 Longevity regulating pathway
    19697 (Rela)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    19697 (Rela)
   05202 Transcriptional misregulation in cancer
    19697 (Rela)
   05203 Viral carcinogenesis
    19697 (Rela)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    19697 (Rela)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    19697 (Rela)
   05221 Acute myeloid leukemia
    19697 (Rela)
   05220 Chronic myeloid leukemia
    19697 (Rela)
   05215 Prostate cancer
    19697 (Rela)
   05222 Small cell lung cancer
    19697 (Rela)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    19697 (Rela)
  09165 Substance dependence
   05030 Cocaine addiction
    19697 (Rela)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    19697 (Rela)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    19697 (Rela)
   04931 Insulin resistance
    19697 (Rela)
   04933 AGE-RAGE signaling pathway in diabetic complications
    19697 (Rela)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    19697 (Rela)
   05135 Yersinia infection
    19697 (Rela)
   05133 Pertussis
    19697 (Rela)
   05134 Legionellosis
    19697 (Rela)
   05152 Tuberculosis
    19697 (Rela)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    19697 (Rela)
   05170 Human immunodeficiency virus 1 infection
    19697 (Rela)
   05162 Measles
    19697 (Rela)
   05164 Influenza A
    19697 (Rela)
   05161 Hepatitis B
    19697 (Rela)
   05160 Hepatitis C
    19697 (Rela)
   05168 Herpes simplex virus 1 infection
    19697 (Rela)
   05163 Human cytomegalovirus infection
    19697 (Rela)
   05167 Kaposi sarcoma-associated herpesvirus infection
    19697 (Rela)
   05169 Epstein-Barr virus infection
    19697 (Rela)
   05165 Human papillomavirus infection
    19697 (Rela)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    19697 (Rela)
   05145 Toxoplasmosis
    19697 (Rela)
   05140 Leishmaniasis
    19697 (Rela)
   05142 Chagas disease (American trypanosomiasis)
    19697 (Rela)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    19697 (Rela)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    19697 (Rela)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    19697 (Rela)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RHD_DNA_bind RHD_dimer
Motif
Other DBs
NCBI-GeneID: 19697
NCBI-ProteinID: NP_033071
MGI: 103290
Ensembl: ENSMUSG00000024927
Vega: OTTMUSG00000016639
UniProt: Q04207 Q548Y4
Structure
PDB: 

Position
19 A; 19 4.34 cM
AA seq 549 aa AA seqDB search
MDDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGYYEADLCPDRSIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFHVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLLLTPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFNGPTEPRPPTRRIAVPTRNSTSVPKPAPQPYTFPASLSTINF
DEFSPMLLPSGQISNQALALAPSSAPVLAQTMVPSSAMVPLAQPPAPAPVLTPGPPQSLS
APVPKSTQAGEGTLSEALLHLQFDADEDLGALLGNSTDPGVFTDLASVDNSEFQQLLNQG
VSMSHSTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGTSGLPNGLSGDEDFSSIADMDF
SALLSQISS
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggacgatctgtttcccctcatctttccctcagagccagcccaggcttctgggccttat
gtggagatcatcgaacagccgaagcaacggggcatgcgattccgctataaatgcgagggg
cgctcagcgggcagtattcctggcgagagaagcacagataccaccaagacacaccccacc
atcaagatcaatggctacacaggaccaggaacagttcgaatctccctggtcaccaaggat
ccacctcaccggcctcatccacatgaacttgtggggaaggactgccgggatggctactat
gaggctgacctctgcccagaccgcagtatccatagcttccagaacctggggatccagtgt
gtgaagaagcgagacctggagcaagccattagccagcgaatccagaccaacaataacccc
tttcacgttcctatagaggagcagcgcggggactatgacttgaatgcagtgcgcctctgc
ttccaggtgacagtgcgggacccagcaggcaggcccctcctcctgacccctgtcctctca
catccgatttttgataaccgggcccccaacactgccgagctcaagatctgccgagtaaac
cggaactctgggagctgcctcggtggggatgagatcttcttgctgtgcgacaaggtgcag
aaagaagacattgaggtgtatttcacgggaccaggctgggaggcacgaggctccttttct
caagctgatgtgcatcggcaagtggccattgtgttccggactcctccgtacgccgacccc
agcctccaggctcctgttcgagtctccatgcagctacggcggccttctgatcgcgagctc
agtgagcccatggagttccagtacttgccagacacagatgatcgccaccggattgaagag
aagcgcaaaaggacctatgagaccttcaagagtatcatgaagaagagtcctttcaatgga
ccaactgaaccccggcctccaacccggcgtattgctgtgcctacccgaaactcaacttct
gtccccaagccagccccgcagccctacaccttcccagcatccctcagcaccatcaacttt
gatgagttttcccccatgctgttaccatcagggcagatctcaaaccaggccctggccttg
gcaccgtcctctgccccagtccttgcccagaccatggtcccttcctcagccatggtacct
ctggctcagcccccagctcctgccccagttctaaccccgggtcctccccagtccctgtct
gcacctgttccaaagagcacccaggctggggaaggcacgctgtcggaagccctgctgcac
ctgcagtttgatgctgatgaagacttgggggccttgcttggcaacagcacagacccagga
gtgttcacagacctggcatctgtggacaactcagagtttcagcagctcctgaaccagggt
gtgtccatgtctcactccacagctgagcccatgctgatggagtaccctgaagctataact
cgcctggtgacagggtcccagaggccccctgacccagctcccacacccctggggacctcg
gggcttcccaatggtctctcaggagatgaagacttctcctccattgcggacatggacttc
tctgctcttttgagtcagatcagctcctaa

DBGET integrated database retrieval system