KEGG   Mus musculus (mouse): 19703
Entry
19703             CDS       T01002                                 

Gene name
Renbp, Age, Rnbp
Definition
(RefSeq) renin binding protein
  KO
K01787  N-acylglucosamine 2-epimerase [EC:5.1.3.8]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00520  Amino sugar and nucleotide sugar metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    19703 (Renbp)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.8  N-acylglucosamine 2-epimerase
     19703 (Renbp)
SSDB
Motif
Pfam: GlcNAc_2-epim
Other DBs
NCBI-GeneID: 19703
NCBI-ProteinID: NP_075621
MGI: 105940
Ensembl: ENSMUSG00000031387
Vega: OTTMUSG00000017682
UniProt: P82343
Position
X A7.3; X 37.49 cM
AA seq 430 aa
MMDLGLLMLQDMEKERETLQVWKKRVEQELDRVIAFWMEHSHDQEHGGFFTCLGRDGKVY
DHLKYVWLQGRQVWMYCRLYRSFERFRRVELLDAARAGGEFLLRYARVAPPGKKCAFVLT
RDGRPVKVQRTIFSECFYTMAMNELWKVTGEVRYQSEAIEMMDQIIHWVREDPAGLGRPQ
LSGALATEPMAVPMMLLSLVEQLGEEDEELTNMYAELGDWCVHRILQHVQRDGQVVLENV
SEDGKELPGCLGRHQNPGHTLEAGWFLLQYALRKGDPKLRMHIIDKFLLLPFHSGWDPEH
GGLFYFQDADGLCPTQLEWNMKLWWPHSEAMIAFLMGYSDSGDPALLHLFYKVAEYTFRQ
FRDPEYGEWFGYLNQEGKVALTIKGGPFKGCFHVPRCLAMCEQILGALLQRLEPAPLDSS
PAVSTHEGSK
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgatggacctaggactcctaatgttacaggacatggagaaggaacgggagacactgcag
gtctggaagaagcgtgtggaacaagagcttgatcgtgtgatcgctttctggatggagcat
tcccatgaccaggaacacgggggcttcttcacatgtcttggccgtgatgggaaggtatat
gatcacctcaaatatgtttggctgcaggggaggcaggtatggatgtattgtcgcttatac
cgcagttttgagcgcttccgccgtgttgagcttctggatgcagcaagagcaggtggtgaa
tttttgctgcgttatgcccgggtggcaccacctggcaagaaatgtgcttttgtgctgact
cgggatggccggccagtgaaggtgcagcggaccattttcagcgagtgcttctacaccatg
gccatgaatgaactgtggaaagtaacgggggaagtgcgttatcagagtgaagccatagag
atgatggatcagatcatccactgggtacgggaggacccggctgggttgggccggcctcag
ctctcaggggcactggccacagagcccatggcagtgcccatgatgctgctcagcctggtg
gagcagcttggagaagaagatgaggagctgaccaacatgtatgcagaactaggggactgg
tgtgtccacaggattcttcagcatgtccagagggatggacaagttgtactggagaatgta
tcagaggatggaaaagagcttcctggttgccttggaagacatcagaacccaggccacaca
ctggaagctggctggtttctgctccagtatgccctcaggaaaggtgaccccaaacttcga
atgcacatcattgacaagtttctcttattgcctttccactctggatgggaccctgaacat
ggaggcctcttctacttccaggatgcggatggtctctgccctacccagctggaatggaac
atgaagctgtggtggccacacagtgaagccatgattgccttcctcatgggttatagtgac
agtggggaccctgccttgctgcatctcttctacaaggtggctgagtacaccttccgccag
tttcgtgatcctgagtatggggaatggtttggctacctgaaccaagagggaaaggtggcc
ctcaccatcaagggaggtccttttaaaggctgcttccatgtgccgcggtgcctggccatg
tgcgagcagattctaggagccctactccaacgccttgagcccgcccccctcgactcctcg
cccgctgtctctacccatgaaggctcgaaataa

DBGET integrated database retrieval system