KEGG   Mus musculus (mouse): 19708Help
Entry
19708             CDS       T01002                                 

Gene name
Dpf2, 2210010M07Rik, BAF45D, Req, ubi-d4
Definition
(RefSeq) D4, zinc and double PHD fingers family 2
  KO
K13196  zinc finger protein ubi-d4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    19708 (Dpf2)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    19708 (Dpf2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Requiem_N PHD PHD_4 zf-C2H2_4 zf-C2H2 zf-H2C2_2 zf-PHD-like
Motif
Other DBs
NCBI-GeneID: 19708
NCBI-ProteinID: NP_035392
MGI: 109529
Ensembl: ENSMUSG00000024826
Vega: OTTMUSG00000026653
UniProt: Q61103
Position
19 A; 19 4.34 cM
AA seq 391 aa AA seqDB search
MAAVVENVVKLLGEQYYKDAMEQCHNYNARLCAERSVRLPFLDSQTGVAQSNCYIWMEKR
HRGPGLASGQLYSYPARRWRKKRRAHPPEDPRLSFPSIKPDTDQTLKKEGLISQDGSSLE
ALLRTDPLEKRGAPDPRVDDDSLGEFPVSNSRARKRIIEPDDFLDDLDDEDYEEDTPKRR
GKGKSKSKGVSSARKKLDASILEDRDKPYACDICGKRYKNRPGLSYHYAHSHLAEEEGED
KEDSRPPTPVSQRSEEQKSKKGPDGLALPNNYCDFCLGDSKINKKTGQPEELVSCSDCGR
SGHPSCLQFTPVMMAAVKTYRWQCIECKCCNLCGTSENDDQLLFCDDCDRGYHMYCLTPS
MSEPPEGSWSCHLCLDLLKEKASIYQNQNSS
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgtggtggagaatgtagtgaagctccttggcgagcaatactacaaagatgcc
atggaacagtgccacaattataacgcccgcctctgtgctgaacgtagtgtgcgcctgcct
ttcctggactcacagactggagtagcccagagcaattgttatatctggatggaaaagcga
caccggggaccaggattggcctctggacagttatactcctatcctgccagacgctggcgg
aaaaagcgccgagcccacccacctgaggatcccaggctttctttcccatcgattaaacca
gacactgaccagactctgaagaaagaggggcttatctctcaggatggcagcagtttagag
gctctgttgcgtactgatcccctggagaaacggggtgccccagatccccgagttgacgat
gacagcctgggcgagtttcctgttagcaacagtcgagcacggaagcggatcattgaaccc
gatgacttccttgatgaccttgatgatgaggactatgaagaagatacgccaaagcgtcgg
gggaaggggaagtccaagagtaagggtgtgagcagtgcccggaagaagctggatgcttcc
atcctggaggaccgggataagccctatgcctgtgacatttgtggaaaacgttacaagaac
cgacctggcctcagttaccactatgcccactcccacctggctgaagaggaaggagaggac
aaagaagactcccgaccccccactcctgtgtcccagaggtctgaggagcagaaatccaag
aaaggacctgatggattggccctgcctaacaactactgtgacttctgcctaggagactca
aaaatcaacaagaagacagggcagcccgaggagctagtgtcctgttccgactgtggccgc
tcagggcatccgtcctgcctgcagttcacccctgtgatgatggcggccgtgaagacctac
cgctggcagtgcatcgaatgcaagtgctgcaacctctgcggcacgtcggagaacgatgac
cagctacttttctgtgatgactgtgaccgtggctaccacatgtactgtctcactccttcc
atgtctgagcctcctgaaggaagttggagttgccacctgtgtctggatctgctgaaggag
aaagcatccatctaccagaaccagaactcctcctga

DBGET integrated database retrieval system