KEGG   Mus musculus (house mouse): 19713
Entry
19713             CDS       T01002                                 
Symbol
Ret, PTC, RET51, RET9, c-Ret
Name
(RefSeq) ret proto-oncogene
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu05200  Pathways in cancer
mmu05216  Thyroid cancer
mmu05223  Non-small cell lung cancer
mmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    19713 (Ret)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    19713 (Ret)
   05230 Central carbon metabolism in cancer
    19713 (Ret)
  09162 Cancer: specific types
   05216 Thyroid cancer
    19713 (Ret)
   05223 Non-small cell lung cancer
    19713 (Ret)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    19713 (Ret)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     19713 (Ret)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  RET family
   19713 (Ret)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr RET_CLD1 RET_CLD4 RET_CLD3 Pkinase Cadherin Pkinase_fungal RIO1 Haspin_kinase ABC1
Other DBs
NCBI-GeneID: 19713
NCBI-ProteinID: NP_033076
MGI: 97902
Ensembl: ENSMUSG00000030110
UniProt: P35546
Structure
Position
6:complement(118128709..118174705)
AA seq 1115 aa
MAKATSGAAGLGLKLILLLPLLGEAPLGLYFSRDAYWERLYVDQPAGTPLLYVHALRDAP
GEVPSFRLGQHLYGVYRTRLHENDWIRINETTGLLYLNQSLDHSSWEQLSIRNGGFPLLT
IFLQVFLGSTAQREGECHWPGCTRVYFSFINDTFPNCSSFKAQDLCIPETAVSFRVRENR
PPGTFYHFHMLPVQFLCPNISVKYSLLGGDSLPFRCDPDCLEVSTRWALDRELREKYVLE
ALCIVAGPGANKETVTLSFPVTVYDEDDSAPTFSGGVGTASAVVEFKRKEGTVVATLQVF
DADVVPASGELVRRYTNTLLSGDSWAQQTFRVEHSPIETLVQVNNNSVRATMHNYKLILN
RSLSISESRVLQLAVLVNDSDFQGPGAGGILVLHFNVSVLPVTLNLPRAYSFPVNKRARR
YAQIGKVCVENCQEFSGVSIQYKLQPSSINCTALGVVTSPEDTSGTLFVNDTEALRRPEC
TKLQYTVVATDRQTRRQTQASLVVTVEGTSITEEVGCPKSCAVNKRRPECEECGGLGSPT
GRCEWRQGDGKGITRNFSTCSPSTRTCPDGHCDAVESRDANICPQDCLRADIVGGHERGE
RQGIKAGYGICNCFPDEKKCFCEPEDSQGPLCDALCRTIITAALFSLIISILLSIFCVCH
HHKHGHKPPIASAEMTFCRPAQGFPISYSSSGTRRPSLDSTENQVPVDSFKIPEDPKWEF
PRKNLVLGKTLGEGEFGKVVKATAFRLKGRAGYTTVAVKMLKENASQSELRDLLSEFNLL
KQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRDSRKIGPAYVSGGGSRNSSSLD
HPDERVLTMGDLISFAWQISRGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDV
YEEDSYVKKSKGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPER
LFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKSRDYLDLA
ASTPSDSLLYDDGLSEEETPLVDCNNAPLPRSLPSTWIENKLYGMSDPNWPGESPVPLTR
ADGTSTGFPRYANDSVYANWMVSPSAAKLMDTFDS
NT seq 3348 nt   +upstreamnt  +downstreamnt
atggcgaaagcgacgtccggcgccgcagggctggggctgaagctgattttgctcctgccg
ctgctaggagaagccccactgggcctctatttctcaagggatgcttactgggagaggctg
tatgtagaccagccagctggcacacctctgctctatgtccatgccctacgggatgcccct
ggagaagtgccgagcttccgcctgggccagcatctctatggcgtctaccgtacacggctg
catgagaatgactggatccgcatcaatgagactactggccttctctacctcaatcagagc
ctggaccacagttcctgggaacagctcagcatccgcaatggtggtttccccctgctcacc
atcttcctccaggtctttctggggtccacagcccagagagagggagaatgccattggcca
ggctgtacccgtgtgtacttctccttcatcaacgacaccttcccaaattgtagctccttc
aaagcccaggatctctgcatcccagagacagccgtgtccttccgagtcagggagaacagg
cctcctggcaccttctaccacttccacatgttacccgtgcagttcctttgtcccaacatc
agtgtgaagtacagtctcttaggaggggatagtctgcccttccgttgtgacccagactgc
ctggaggtgagcactcgctgggccctggatcgagagctccgggagaagtatgtgctggag
gctttgtgcatagtggcaggccctggtgccaacaaagagacggtgactctgtccttccca
gtgacagtgtatgatgaggacgactcggcgcccaccttctctggaggtgtgggcactgcc
agcgcggtggtggagtttaagcggaaggagggcactgtggtggccaccctgcaggtgttc
gatgcagatgtggtgccagcgtctggggagctggtgagacggtacacaaacacactcctc
tcaggggactcctgggcccagcagaccttccgggtggagcattcgcccatcgagaccttg
gtccaggtcaacaacaactccgttcgggcaaccatgcacaattacaagctgattctcaac
aggagcctgtctatctcagagagccgagtcctgcagctcgcggtcctggtcaacgactca
gacttccaggggcctggggcaggtggtatcctcgtcctccatttcaacgtgtctgtactg
cccgtcaccctgaacctacccagggcctactccttcccagtgaataagagggcccgccgc
tatgcccagatcgggaaagtctgtgtggaaaactgccaggagttcagcggtgtctccatc
cagtacaagctgcagccttccagcatcaactgcactgccctaggtgtggtcacctcaccc
gaggacacctcggggaccctatttgtaaatgacacagaggccctgcggcgacctgagtgc
accaagcttcagtacacggtggtagccactgaccggcagacccgcagacagacccaggct
tcgctagtggtcactgtggaggggacatccattactgaagaagtaggctgccccaagtcc
tgtgcagtaaacaagaggcgccccgagtgtgaggaatgtggtggcctgggttctccaact
ggcaggtgcgagtggcgccagggagatggtaaagggatcaccaggaacttctccacctgc
tcccccagtaccaggacctgccccgacggccactgtgatgctgtggagagccgggatgcc
aacatttgcccccaggactgtctccgtgccgacattgttggaggacacgagcgaggggag
cgccagggcattaaagcaggctacggcatctgcaactgtttccctgatgagaagaaatgc
ttctgcgagccagaggacagccagggcccactgtgtgatgcgctgtgccgcacgatcatc
acagctgccctcttctcccttatcatctccatcctgctgtccatcttctgtgtctgccac
caccacaagcatgggcacaagccgcccattgcatcagcggaaatgaccttctgccggccg
gcccagggcttcccaatcagttattcctcctcaggcacccgccggccctcactggattcc
acggagaaccaggttcctgtggactctttcaagatcccggaggatccaaagtgggaattt
cctcggaagaacttagttcttgggaaaactctgggagaaggcgagtttggaaaagttgtc
aaggccacagccttccgtctgaaaggccgggcaggatacaccacagtggctgtgaaaatg
ctgaaagaaaacgcctcccagagtgagttacgagacctgctgtctgagttcaaccttctg
aaacaagtcaaccatccacatgtcatcaagttgtatggggcctgcagccaggatgggcca
cttcttctcattgtggagtatgccaagtatggctccctgcggggattcctccgtgacagc
cgcaagattgggcctgcctatgtgagcggtggaggcagccgcaactccagctcgctggac
cacccagatgaaagggtactgaccatgggtgacctcatctccttcgcctggcagatctcg
aggggtatgcagtacttggcagaaatgaagcttgtacatcgggacttagctgccaggaac
atcttggtggctgagggacggaagatgaagatttccgactttgggctgtcccgagatgtt
tatgaggaagattcctatgtgaagaaaagcaagggccggattcccgtcaagtggatggca
attgagtcccttttcgatcacatctatactactcaaagtgatgtgtggtcctttggagtg
ctgctctgggagattgtgaccctgggaggcaacccctaccctggaattcctcctgaacga
ctcttcaaccttctgaagacaggccacaggatggagaggccagacaactgcagcgaggaa
atgtaccgtctgatgctgcagtgctggaagcaggagccagacaagaggccagtgtttgct
gacatcagcaaggatctggagaagatgatggtcaagagcagagactacttggacctggct
gcatccacaccttcggactcactgctgtatgacgatgggctctcagaagaggagacaccc
ctggtggactgtaacaatgctcccctcccgcgctccctcccttccacatggattgaaaac
aaactctatggcatgtcagacccgaactggcctggagagagtcctgtaccactcacgaga
gccgatggcactagcactgggttcccaagatatgcaaatgatagtgtatatgctaactgg
atggtttcaccctcagcggcaaaattaatggacacatttgatagctaa

DBGET integrated database retrieval system