KEGG   Mus musculus (mouse): 19724
Entry
19724             CDS       T01002                                 

Symbol
Rfx1, AI047719, AI385641
Name
(RefSeq) regulatory factor X, 1 (influences HLA class II expression)
  KO
K09173  regulatory factor X 1/2/3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    19724 (Rfx1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Other basic domains
   RF-X
    19724 (Rfx1)
SSDB
Motif
Pfam: RFX1_trans_act RFX_DNA_binding
Other DBs
NCBI-GeneID: 19724
NCBI-ProteinID: NP_033081
MGI: 105982
Ensembl: ENSMUSG00000031706
Vega: OTTMUSG00000061193
UniProt: P48377
Position
8:84789787..84823630
AA seq 963 aa
MATQSYVTELQAAPQASQPPQAPPQALPQPPPPAAPQPPAAATPQPQYVTELQSPQPQTQ
PPGSQKQYVAELPAAPAPSQPATPAPSPVAQQYIVVTVSEGAMRASETVSEASPSSTASQ
TGVPTQVVQQVQGTQQRLLVQASVQAKPGHVSPLQLTNIQVPQQAIPTQHLVVQSPAPGT
KSGQVSLTVHSAQQVHSAPERSPVQANNSTSKTAGTPAATVQQLQVHSVQQSVPVTQERS
VVQATPQTKAGPVQQLTVQGLQPVHVAQEVQQLPQVPVPHVYSSQVQYVEGGDASYTASA
IRSSTYQYPETPIYTQTAGTSYYEASGTAAQVSTPATSQTVASSGSVPMYVSGSPIVASS
SSSEAGASNSSVGAGGNGGGGSSGGGSGGSSGSGAGTYVIQGGYMLGNASQSYSHTTRAS
PATVQWLLDNYETAEGVSLPRSTLYCHYLLHCQEQKLEPVNAASFGKLIRSVFMGLRTRR
LGTRGNSKYHYYGLRIKASSPLLRLMEDQQHMAMRGQPFSQKQRLKPIQKMEGVANGVAV
GQQSTGLSDISAQVQQYQQFLDASRSLPDFAELDLQGKVLPEGVGPGDIKAFQVLYREHC
EAIVDVMVNLQFTLVETLWKTFWRYNLSQPSEAPPLAVHDEAEKRLPRASLVLLSKFQPV
LQWTKHCDNVLYQGLVEILIPDVLRPIPSALTQAIRNFAKSLESWLTHAMVNIPEEMLRV
KVAAAGAFAQTLRRYTSLNHLAQAARAVLQNTAQINQMLSDLNRVDFANVQEQASWVCRC
EDRVVQRLEQDFKVTLQQQNSLEQWAAWLDGVVSQVLKPYQGSSGFPKAAKLFLLKWSFY
SSMVIRDLTLRSAASFGSFHLIRLLYDEYMYYLIEHRVAQAKGETPIAVMGEFANLATSL
NPLDPDKDEEEEEEEESEDELPQDISLAAGSESPALGPEALEPPAKLARTDTRGLFVQAL
PSS
NT seq 2892 nt   +upstreamnt  +downstreamnt
atggcaacacagtcctatgttactgagctacaggcagccccacaagcatcccagccgcca
caggccccgccccaggccctgccccagccaccacccccagcagcaccccagcctcctgct
gcagcaaccccccagccccagtatgtcaccgagctgcaaagcccccagccccagacgcaa
cctccgggcagccagaagcagtatgtggcagagctccctgctgcccctgcaccctcacag
cctgccacacctgccccatcccctgtggctcagcagtatatcgtggtcaccgtatcggaa
ggtgccatgcgggctagtgagactgtgtcagaagccagccccagttccacggcaagccag
accggtgttcccacccaagtggtccagcaggtgcagggcacccagcagcggctgctggtc
caggcaagtgtgcaggccaagccaggccatgtgtcccccctgcagcttaccaacattcag
gtgccacagcaggctatccccacacagcacctggtggtgcagagcccagcaccgggcact
aagagtggccaggtctccctgacggtgcacagtgcccagcaggtgcactctgctcctgag
aggtcaccagtgcaggccaacaactccaccagcaagacagctgggactcctgcggccact
gtgcagcaactacaggtccacagcgtccagcagagtgtccctgtcacccaagagaggtca
gtagtccaggccactccacagaccaaagctggcccggtgcagcagctgactgtgcaggga
ctgcagccagttcacgttgctcaagaggtacagcaactccctcaggtgcctgtcccacac
gtgtattccagccaggtgcagtacgtggaaggtggcgatgccagctacacagccagcgcc
atccgctctagcacctaccagtacccggagacgcctatctacacgcagacggcaggcacc
agctactatgaggcttcgggcacggctgcccaggtcagcacgccggctacttcccagacg
gtggccagcagcggctcagtgcccatgtatgtgtccggcagcccaattgtcgccagctca
tccagcagcgaggctggggccagcaacagcagtgtgggtgcagggggcaatgggggaggc
ggcagcagtggtggtggcagtggcggcagcagcggcagcggagcaggcacctacgtgatc
caaggcggctacatgctaggcaatgccagccagtcttactcccacaccacccgtgcctca
ccagccacagtccagtggctcctggataattacgagaccgctgagggcgtgagcctgcca
cggagcaccctctactgccactacctgctgcactgccaagagcagaagctggagccagtt
aatgccgcctctttcggcaagctcatccgctcggtattcatgggtctgcgcacgcgccgt
ctgggcaccaggggcaactctaagtaccactattacggcctgcggatcaaagccagctca
cccctgctgcggctgatggaggaccagcagcacatggccatgcggggccagcccttctcc
cagaaacagaggctgaagcccatccagaagatggagggcgtggccaacggtgttgccgtg
gggcagcagagcacagggctgtcagacatcagcgcccaggtgcagcagtaccagcagttc
ctggatgcctccaggagcttgcctgattttgctgagttggacctccagggcaaagtgctg
cctgagggtgtcggtcctggggacatcaaggccttccaggtcctgtaccgggagcactgt
gaggccatcgtggacgtcatggtaaacctgcagttcacactggtagaaacgctgtggaag
accttctggagatacaaccttagccagcccagtgaggctccaccactggccgtgcatgac
gaggccgagaagcggctgcccagggccagtctggtgctcctctccaagttccagcctgtg
cttcagtggaccaagcactgtgacaatgtgctgtaccagggcctggtggagatcctcatc
cctgatgttctgcggcccatccccagtgccttgacccaagcaatccggaactttgccaag
agcctggagagctggctcacccatgccatggtgaacatccctgaggagatgctgcgggtg
aaggtggcagcagctggcgccttcgcacagacactgcggcgctacacatcgctcaaccac
ttggcgcaggcggcgcgggcagtgctgcagaacactgcacagatcaaccagatgctaagc
gacctcaatcgggtggacttcgcaaacgtccaggagcaggcctcgtgggtgtgtcgctgt
gaggaccgtgtggtgcagcgtttggagcaggacttcaaggtgacgctgcagcagcagaac
tcactggagcaatgggcagcctggctggacggcgttgtgagccaggtgctcaagccctac
cagggcagttccggcttccccaaggcggccaagctcttcctcctcaagtggtccttctac
agctccatggtaatccgggacctgaccctgcgcagtgctgccagcttcggctccttccac
ctcatccggctgctctatgacgagtacatgtactacctgatcgagcacagagtggcccag
gccaagggcgagaccccaatcgcagtcatgggagagtttgcaaacctggccacctcactg
aatcccttggaccctgacaaagatgaagaagaagaggaggaagaggagagtgaggatgag
ctgccacaagacatctcgctggcggctggcagcgagtctcccgcactaggccctgaagct
ctggagccaccagcgaaactggcgcggactgacactcgtggcctctttgtgcaggccctg
ccctccagctaa

DBGET integrated database retrieval system