KEGG   Mus musculus (mouse): 19726
Entry
19726             CDS       T01002                                 

Symbol
Rfx3, C230093O12Rik, MRFX3
Name
(RefSeq) regulatory factor X, 3 (influences HLA class II expression)
  KO
K09173  regulatory factor X 1/2/3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    19726 (Rfx3)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Other basic domains
   RF-X
    19726 (Rfx3)
SSDB
Motif
Pfam: RFX1_trans_act RFX_DNA_binding DUF2258 Pox_D5 HisKA
Other DBs
NCBI-GeneID: 19726
NCBI-ProteinID: NP_001159886
MGI: 106582
Ensembl: ENSMUSG00000040929
Vega: OTTMUSG00000037650
UniProt: P48381
Position
19:complement(27739121..27995287)
AA seq 749 aa
MQTSETGSDTGSTVTLQTSVASQAAVPTQVVQQVPVQQQVQQVQTVQQVQHVYPAQVQYV
EGSDTVYTNGAIRTTTYPYTETQMYSQNTGGNYFDTQGSSAQVTTVVSSHSMVGTGGIQM
GVTGGQLISSSGGTYLIGNSMENSGHSVTHTTRASPATIEMAIETLQKSDGLSTHRSSLL
NSHLQWLLDNYETAEGVSLPRSTLYNHYLRHCQEHKLDPVNAASFGKLIRSIFMGLRTRR
LGTRGNSKYHYYGIRVKPDSPLNRLQEDMQYMAMRQQPMQQKQRYKPMQKVDGVADGFTG
SGQQTGTSVEQTVIAQSQHHQQFLDASRALPEFGEVEISSLPDGTTFEDIKSLQSLYREH
CEAILDVVVNLQFSLIEKLWQTFWRYSPSTPADGTTITESSNLSEIESRLPKAKLITLCK
HESILKWMCNCDHGMYQALVEILIPDVLRPIPSALTQAIRNFAKSLEGWLSNAMNNIPQR
MIQTKVAAVSAFAQTLRRYTSLNHLAQAARAVLQNTSQINQMLSDLNRVDFANVQEQASW
VCQCDDNMVQRLETDFKMTLQQQSTLEQWAAWLDNVMMQALKPYEGRPSFPKAARQFLLK
WSFYSSMVIRDLTLRSAASFGSFHLIRLLYDEYMFYLVEHRVAQVTGETPIAVMGEFGDL
NAVSPGNLDKDEGSEVESETDEDLDDSSEPRAKREKTELSQAFPVGCMQPVLESAVQPSL
LNPLHSEHIVTSTQTIRQCSATGNTYTAV
NT seq 2250 nt   +upstreamnt  +downstreamnt
atgcagacttcagagacgggttcagacacaggttcgacagtgactctgcagacgtctgtg
gctagccaagcagcagtgcctacacaggtggtacagcaagtgccagtgcagcagcaggtg
cagcaggtacagacagttcagcaggtccaacatgtctacccagctcaggtgcagtatgtg
gaaggaagtgatactgtctataccaatggagcaatccgaacaacaacttatccctacaca
gaaacacagatgtacagccaaaacactggaggaaattactttgatactcaaggaagttct
gcccaggtgacaactgtggtgtcctcccacagtatggtgggtactggtgggattcagatg
ggcgtcacaggaggacaactcatcagcagctcgggaggaacctatttgatcggcaattca
atggagaactctggtcactcagtgacacacacaactcgggcctccccagcaacaattgaa
atggcgattgagacgctgcaaaagtctgacggtctgtccactcacagaagctctcttctc
aacagccatctgcaatggctgctggacaattatgagacagcggagggagtgagcctgccg
aggagcacgctgtacaaccactaccttcgacactgccaggagcacaagctggacccggtc
aatgccgcctctttcggaaaactaataaggtccatttttatggggctacgaactaggaga
ttaggcactagaggaaactccaaataccattactatgggattcgtgtgaagccagattct
cctcttaaccgtctacaagaagatatgcagtacatggctatgaggcagcagcccatgcaa
cagaagcaaaggtacaagcctatgcagaaagtggatggggttgcagatggtttcacagga
agtggccaacagacaggcacatctgttgagcaaactgtaattgcccaaagtcaacatcat
caacagtttttagatgcatctcgagcacttccagagtttggagaagttgaaatctcttct
ctgccagatggtactacctttgaggatatcaagtcactgcagagtctttatcgagagcac
tgtgaggcaatactggacgttgttgtgaatcttcagtttagcctgatagaaaaactgtgg
caaacattctggcgctattccccatctactccagccgacggcactaccatcacggaatca
agcaatctgagtgaaatagaaagtcgacttccgaaagcaaagctgataactctgtgcaaa
catgagtctatcctgaaatggatgtgtaactgtgaccatgggatgtaccaggctttggtg
gagattctcatccccgacgtccttagacccattcctagtgccttgacccaagccattcga
aatttcgcaaaaagcctagaaggttggctttcaaatgccatgaacaatattccacagaga
atgattcaaaccaaggttgccgctgtaagtgcctttgctcagactctgcgaagatacaca
tcgctcaatcacctggcccaggcagcccgcgcagtgcttcagaacacttcccagatcaac
cagatgctcagtgacctcaaccgcgttgactttgccaatgtccaggagcaggcttcctgg
gtgtgccagtgtgatgacaacatggttcagagactagaaacagacttcaagatgaccctg
cagcagcagagcactctggagcagtgggctgcttggctggacaatgtgatgatgcaagcg
ctgaagccctatgaaggaaggcccagcttcccgaaggctgctcggcagtttctgctcaag
tggtctttctacagctccatggttatccgggacttaaccttgcgcagtgctgctagcttt
ggctcctttcacctgatccggctgctctatgatgagtacatgttctacttagtagagcat
cgtgttgctcaagtgacaggagagacaccgatagcagtgatgggtgagtttggcgattta
aatgctgtatctcccggaaatctggataaagatgaaggcagcgaagtcgaaagtgagacg
gatgaagatctggatgattcttcagagcctcgggccaaaagggagaaaacggagctgagc
caggcgttcccagtaggctgcatgcagcctgttctggagagtgctgtgcagcccagcctc
ctgaaccccctacacagcgagcacatcgtcacaagtacacagaccatcaggcagtgcagc
gccacaggcaacacctacactgcagtctaa

DBGET integrated database retrieval system