KEGG   Mus musculus (mouse): 19731Help
Entry
19731             CDS       T01002                                 

Gene name
Rgl1, Rgl, mKIAA0959
Definition
(RefSeq) ral guanine nucleotide dissociation stimulator,-like 1
  KO
K17635  ral guanine nucleotide dissociation stimulator-like 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04014  Ras signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    19731 (Rgl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF RasGEF_N RA DUF5643 Dehyd-heme_bind
Motif
Other DBs
NCBI-GeneID: 19731
NCBI-ProteinID: NP_058542
MGI: 107484
Ensembl: ENSMUSG00000026482
Vega: OTTMUSG00000022514
UniProt: Q60695
Structure
PDB: 

Position
1; 1 G2-G3
AA seq 768 aa AA seqDB search
MKLLWQAKMSSIQDWGEEVEEGAVYHVTLKRVQIQQAANKGARWLGVEGDQLPPGHTVSQ
YETCKIRTIKAGTLEKLVENLLTAFGDNDFTYISIFLSTYRGFASTKEVLELLLDRYGNL
TGPNCEDDGSQSSPESKAVIRNAIASILRAWLDQCAEDFREPPHFPCLQKLLEYLKQMMP
GSDPERRAQNLLEQFQKQDVDSDNGLLNTSSFSLEEEEELESGGSAEFTNFSEDLVAEQL
TYMDAQLFKKVVPHHCLGCIWSQRDKKENKHLAPTIRATISQFNTLTKCVVSTVLGSKEL
KTQQRARVIEKWINIAHECRILKNFSSLRAIVSALQSNSIYRLKKAWAAVPKDRMLMFEE
LSDIFSDHNNHLTSRELLMKEGTSKFANLDSSVKENQKRTQRRLQLQKDMGVMQGTVPYL
GTFLTDLTMLDTALQDYIEGGLINFEKRRREFEVIAQIKLLQSACNSYCMGPDQKFIQWF
QRQQLLSEEESYALSCEIEAAADANTTSPKPRKSMVKRLSLLFLGSDIIPGSTPTKEQPK
SAASGSSGESMDSVSVSSCESNHSEAEEGPVTPMDTPDEPQKKLSESSSSCSSIHSMDTN
SSGMSSLINPLSSPPTCNNNPKIHKRSVSVTSITSTVLPPVYNQQNEDTCIIRISVEDNN
GNMYKSIMLTSQDKTPAVIQRAMSKHNLESDPAEEYELVQVISEDKELVIPDSANVFYAM
NSQVNFDFILRKKNSVEEQVKLRSRTSLTLPRTAKRGCWSNRHSKITL
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atgaaattactttggcaagctaaaatgagctcgattcaggactggggtgaagaggtagag
gaaggagctgtttaccatgtcaccctcaaaagagtccagattcaacaggcggccaataaa
ggagcgagatggctaggggttgaaggggaccagctgcctccaggacacacagtcagtcag
tacgagacctgcaagatcaggaccatcaaagctggtacgctggagaagcttgtggagaac
ctgctgacggcttttggggacaatgactttacctacatcagcatctttttgtcgacatac
agaggctttgcctcgactaaggaagtgctggagctgctgctggacaggtatggaaacctg
acaggcccaaactgtgaagacgatggaagccaaagttcacccgagtccaaggccgtgatc
cggaatgccattgcttccatcctgagggcctggcttgaccagtgtgcggaagacttccgg
gagccccctcacttcccttgccttcagaagctgctggagtacctcaaacagatgatgcct
ggctctgacccagagaggagagcacagaaccttcttgaacagtttcaaaagcaggacgtg
gattccgacaatggacttctcaacaccagctccttcagcctggaagaggaagaggaactg
gagagcggagggtcagcagaattcacgaacttctcagaagatctcgtggcagaacagctg
acctacatggacgcacaactattcaagaaggtagtgcctcaccattgcctgggctgtatt
tggtctcagcgggataaaaaggaaaacaagcatttggctcctacgatccgtgccaccatc
tctcagtttaatacgctcaccaagtgtgttgtcagcaccgtcctggggagcaaggaactc
aaaactcagcagcgagccagagtcatcgagaagtggatcaacattgctcacgaatgtaga
atcctgaagaatttttcctccttgagggccatcgtttccgcactgcagtctaattccatc
tatcggttgaaaaaggcttgggctgctgtcccgaaggacagaatgctgatgtttgaagaa
ctttcagatatcttctctgatcacaataaccatctaaccagtcgggagctactaatgaag
gaaggaacttcaaaatttgcaaacctggacagcagcgtgaaagaaaaccagaagcggacc
cagaggcgcctgcaactgcagaaggatatgggtgtgatgcagggtaccgtgccttacctg
ggcaccttcctgactgacctgaccatgctggacactgccctgcaggactacattgagggt
ggactgatcaacttcgagaaaagaagaagggaatttgaagtcattgcccagataaagctc
ctacagtctgcttgcaacagctactgcatgggcccagaccagaagtttatccagtggttc
cagaggcagcagcttctatcagaggaggaaagctacgccctctcgtgtgagattgaagcc
gctgccgacgccaacaccacttcccctaagcctcggaaaagcatggtgaagaggctgagc
ctgctatttctggggtctgacatcatccccgggagcactcccaccaaagagcagcccaag
tccgcagccagtgggagctctggggagagtatggactcagtcagtgtgtcgtcctgtgaa
tcaaaccactccgaggctgaggagggccccgtcacacccatggacacaccagatgagccc
caaaagaagctctctgaatcctcctcttcctgttcctccatccattccatggacacgaat
tcctcagggatgtcgtccctaatcaaccccctgtcctcccctccaacgtgcaacaacaat
cctaaaatccacaagcgctccgtctccgtgacatccattacctccacagtactgcctcct
gtttacaatcagcagaacgaagacacctgcatcatccgcatcagtgtagaagacaacaat
ggcaacatgtacaagagcatcatgctgacaagccaggataagacccccgctgtgatccag
agagcgatgtcgaagcacaacctggagtcggaccccgccgaggagtatgagctggtgcag
gtcatctcggaggacaaagaactagtgatcccggactctgcaaacgtcttttacgccatg
aatagccaagtgaactttgatttcattttacgcaaaaagaactcggtggaggagcaggtg
aagttgcgcagtcggaccagcctgactttgcccaggacagctaagcggggctgctggagt
aacaggcacagcaagatcaccctctga

DBGET integrated database retrieval system