KEGG   Mus musculus (mouse): 19732
Entry
19732             CDS       T01002                                 

Gene name
Rgl2, KE1.5, R, Ra, Rab2l, Rgt, Rgt2, Rlf
Definition
(RefSeq) ral guanine nucleotide dissociation stimulator-like 2
  KO
K17636  ral guanine nucleotide dissociation stimulator-like 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04014  Ras signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    19732 (Rgl2)
SSDB
Motif
Pfam: RasGEF RA RasGEF_N Nup_retrotrp_bd
Other DBs
NCBI-GeneID: 19732
NCBI-ProteinID: NP_033085
MGI: 107483
Ensembl: ENSMUSG00000041354
Vega: OTTMUSG00000037071
UniProt: Q61193
Structure
PDB: 
4JGW 5CM8 5CM9 1RLF

Position
17; 17 B1
AA seq 778 aa
MLPRPLRLLLDTTPPGGVVLSSFRSRDPEEGGDPGGRAVGGGQEEEDEEEEEASVSVWDE
EEDGATFTVTSRQYRPLDPLAPLPPPRSSRRLRAGTLEALVRHLLDARTAGADMMFTPAL
LATHRAFTSTPALFGLVADRLEALESHPPGELERTTGVAISVLSTWLASHPEDFGSEVKG
QLDRLESFLLRTGYAAREGVVGGSADLIRNLRARVDPRAPDLPKPLALPGDSPADPTDVL
VFLADHLAEQLTLLDAELFLNLIPSQCLGGLWGHRDRPGHSHLCPSVRATVTQFNKVAGA
VVSSVLGATSIGEGPREVTVRPLRPPQRARLLEKWIRVAEECRLLRNFSSVYAVVSALQS
SPIHRLRAAWGETTRDSLRVFSSLCQIFSEEDNYSQSRELLMQEVKPQPPVEPHSKKAPR
SGFRGGGVVPYLGTFLKDLVMLDAASKDELENGYINFDKRRKEFAILSELLRLQKECRGY
DLRPNSDIQQWLQGLQPLTEAQSHRVSCEVEPPGTSDSPAARTPRPTLVITQWTEVLGSV
GGPTPLVSWDRPSVGGDEVPGTPAPLLTRLAQHMKWPSVSSLDSALESSPSLHSPADPGH
LSPPASSPRPSRGHRRSASCGSPLSGNTGEGTSRSAGCGGGVSGPGSSDCRIIRVQMELG
EDGSVYKSILVTSQDKAPSVISRVLKKNNRDSAVASEFELVQLLPGDRELTIPHSANVFY
AMDGASHDFLLRQRRRPSAATPGSHSGPSASGTPPSEGGGGSFPRIKATGRKIARALF
NT seq 2337 nt   +upstreamnt  +downstreamnt
atgctcccgcggcccctgcggctgcttttggacacgaccccccccgggggagtcgtgctg
agcagcttccggagccgggaccccgaagagggtggggacccaggtggccgggccgtgggc
ggggggcaggaggaagaggatgaggaagaagaagaggcttctgtgtcagtctgggacgag
gaggaggatggtgcgacctttactgtcacaagccgccagtacaggcctcttgaccccttg
gctcccttgcctccacctcgctcctcccgacggctccgcgctggcactctggaggccctg
gtcagacacctcttggatgccaggacagcaggggctgacatgatgttcactccggccttg
ctggccacccaccgggccttcacctccactcctgccctgtttgggcttgtggctgacagg
ctggaagcccttgaatctcatcctcccggtgagctagagaggaccacaggggtagccatc
tctgtactttcaacttggctggcctctcaccctgaggattttggctctgaggtcaagggt
caacttgaccggcttgagagcttcttgcttcggacagggtatgcagcacgggagggtgtt
gtggggggcagtgctgacctcatccgaaacctccgggcccgggtggacccccgggccccc
gaccttcctaagcccctggcccttcctggcgattcccctgctgaccccacggatgtcctg
gtgttcctcgctgaccacttggccgaacagctgaccctgctagatgcggaactgtttctt
aatctgatcccctctcagtgtttgggaggcctctggggtcacagagaccggccaggacat
tctcacctctgcccgtctgtccgagctaccgtcacacagttcaacaaggtggcgggggcg
gtagttagctctgtcttgggggccacctcaattggagaggggccaagagaggtgactgtg
agaccactgcggcccccacagagggcccggctcctagagaagtggatccgtgtggccgag
gagtgccgcctgcttcggaacttctcctcagtgtatgctgttgtgtccgctctgcagtcc
agccctatccacaggcttcgggcagcctggggggagacaaccagggacagcctccgagtc
ttttccagcctgtgccagattttctcagaggaggataattattcccagagcagagagctc
ctcatgcaggaagtgaagccgcagccccctgtggagccacactccaagaaggccccaagg
tctggcttcaggggtgggggtgtggttccctacctgggaaccttcctgaaggacctcgtg
atgctggatgcggcctccaaggatgagctggagaatggctacatcaattttgacaagcgg
aggaaggagtttgctatcctttcggagctgttgcgcctccagaaagaatgtcgtggctac
gacctccgacctaactctgatatccagcaatggctccagggcctccagcctttaactgaa
gctcagagtcaccgtgtatcctgtgaagtggagccaccagggaccagtgactcccccgct
gcaaggacacctcggccaacactagtgatcacacagtggacggaagttctgggctctgtt
ggaggccccactccgcttgtgtcctgggatcggcccagtgtcgggggagatgaggtgcct
ggaaccccagcacctctgctgactcgcctcgcccagcacatgaagtggccatcagtctca
tctctggactctgccctggaaagcagcccctccttgcacagccctgctgaccctggccac
ctctctcctccagcctcctcccctaggccttcccggggtcaccgtcgctcagcctcctgt
gggtctccgttgagtggaaacacaggagaagggacctctaggagtgctggatgtgggggc
ggggtatctgggccagggtcctctgattgccgaatcatccgagtccagatggagctgggg
gaggatggcagcgtctacaagagcatcctggtgacaagccaggacaaagctccaagtgtt
attagtcgtgtccttaagaaaaacaatcgtgattctgctgtggcttcagagttcgagctg
gtgcagctgctacctggggatcgagagctgaccatcccacactcagctaacgtcttctat
gccatggatggtgcatctcatgacttcctcctgcggcagcgcagaagaccctctgctgcc
accccgggttcccacagcggcccctctgcctcaggaactcctccgagcgaggggggaggg
ggctcctttcccaggatcaaggccacggggaggaagattgcacgggcactgttctga

DBGET integrated database retrieval system