KEGG   Mus musculus (mouse): 19735
Entry
19735             CDS       T01002                                 

Gene name
Rgs2, GOS8
Definition
(RefSeq) regulator of G-protein signaling 2
  KO
K18154  regulator of G-protein signaling 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04740  Olfactory transduction
mmu04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    19735 (Rgs2)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    19735 (Rgs2)
  09157 Sensory system
   04740 Olfactory transduction
    19735 (Rgs2)
SSDB
Motif
Pfam: RGS
Other DBs
NCBI-GeneID: 19735
NCBI-ProteinID: NP_033087
MGI: 1098271
Ensembl: ENSMUSG00000026360
Vega: OTTMUSG00000020882
UniProt: O08849
Position
1 F; 1 62.56 cM
AA seq 211 aa
MQSAMFLAVQHDCVPMDKSAGNGPKVEEKREKMKRTLLKDWKTRLSYFLQNSSAPGKPKT
GKKSKQQTFIKPSPEEAQLWAEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFK
KTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKSLIAQNIQEATSGCFTTAQKRVYSL
MENNSYPRFLESEFYQDLCKKPQITTEPHAT
NT seq 636 nt   +upstreamnt  +downstreamnt
atgcaaagtgccatgttcctggctgtccagcacgactgcgtacccatggacaagagtgca
ggcaacggccccaaggtcgaggagaagcgggagaaaatgaagcggacactcttaaaggat
tggaagacccgtttgagctacttcttgcagaattcctctgctcctgggaagcccaaaact
ggcaagaaaagcaaacagcaaacttttatcaagccttctcctgaggaagcgcagctctgg
gcagaagcatttgatgaactgctggccagtaaatatgggctggctgcattcagggcgttt
ttaaagtccgagttctgtgaagaaaacattgaattctggttggcttgtgaagacttcaaa
aaaaccaaatcaccccaaaaactgtcctcaaaagcaaggaaaatctataccgacttcata
gagaaggaagctcccaaagagataaacatagacttccaaacgaaatctctgattgcccaa
aatatccaagaggctacaagtggctgcttcaccacagctcagaagagggtgtacagtttg
atggagaacaattcttatcctcggttcttggagtccgaattctaccaggacttatgtaaa
aagccacagatcaccacggagccccatgctacatga

DBGET integrated database retrieval system