KEGG   Mus musculus (mouse): 19736Help
Entry
19736             CDS       T01002                                 

Gene name
Rgs4, AA004315, AA597169, ESTM48, ESTM50
Definition
(RefSeq) regulator of G-protein signaling 4
  KO
K16449  regulator of G-protein signaling
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    19736 (Rgs4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RGS
Motif
Other DBs
NCBI-GeneID: 19736
NCBI-ProteinID: NP_033088
MGI: 108409
Ensembl: ENSMUSG00000038530
Vega: OTTMUSG00000020909
UniProt: O08899 Q5D078
Position
1 H2.3; 1 76.84 cM
AA seq 205 aa AA seqDB search
MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHSSSHSKKDKVVTCQRVSQEEVKKWA
ESLENLIHHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFIS
VQATKEVNLDSCTREETSRNMLQPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLTNP
SSCGAEKQKGAKSSADCTSLVSQCA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtgcaaaggacttgcaggtctgccggcttcctgcctgaggagtgcaaaggacatgaaa
catcggctggggttcctgctgcagaagtcagattcctgcgaacacagttcttcacacagc
aagaaggacaaagtagtaacttgccagagggtaagccaagaagaagtcaagaaatgggct
gaatcgttggaaaacctgattcaccatgaatgtggactggcagctttcaaagctttcctg
aagtcggaatacagcgaggagaacattgacttctggatcagctgtgaggagtacaagaag
atcaagtcaccttctaaactaagtcccaaagccaagaagatctacaacgagttcatctca
gtgcaagcaacaaaagaggtgaacctggactcttgcaccagagaggagacaagccggaac
atgttacagcccacaataacctgttttgatgaagcccagaagaagattttcaacctgatg
gaaaaggattcctaccgccgcttcctcaagtctcgattctatcttgacctgaccaatcct
tccagctgcggggcagagaagcagaaaggagccaagagttctgcagactgcacttccctg
gtctcccagtgtgcctaa

DBGET integrated database retrieval system