KEGG   Mus musculus (mouse): 19737Help
Entry
19737             CDS       T01002                                 

Gene name
Rgs5, 1110070A02Rik
Definition
(RefSeq) regulator of G-protein signaling 5
  KO
K16449  regulator of G-protein signaling
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    19737 (Rgs5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RGS
Motif
Other DBs
NCBI-GeneID: 19737
NCBI-ProteinID: NP_033089
MGI: 1098434
Ensembl: ENSMUSG00000026678
Vega: OTTMUSG00000020901
UniProt: O08850
Position
1 H2.3; 1 76.84 cM
AA seq 181 aa AA seqDB search
MCKGLAALPHSCLERAKEIKIKLGILLQKPDSAVDLVIPYNEKPEKPAKAHKPSLEEVLQ
WRQSLDKLLQNSYGFASFKSFLKSEFSEENLEFWVACENYKKIKSPIKMAEKAKQIYEEF
IQTEAPKEVNIDHFTKDITMKNLVEPSPRSFDLAQKRIYALMEKDSLPRFVRSEFYKELI
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaagggactggcagctctgccgcactcatgcctggaaagggccaaggagatcaag
atcaagttgggaattctcctccagaagccagactctgctgttgaccttgtcattccatac
aatgagaagccagagaagcctgccaaggcacacaagccctcactggaggaggtcctgcag
tggcgccagtccctggacaagcttctccagaacagctatggatttgccagcttcaaaagt
ttcctgaagtctgaattcagtgaggaaaaccttgagttctgggttgcctgtgagaattac
aagaagatcaagtcccccatcaaaatggcggagaaggcaaagcaaatttatgaagaattc
atccagacagaggcccctaaagaggtgaacattgaccacttcactaaagacatcaccatg
aagaacctggtggaaccgtctcctcgcagctttgacttggcccagaaaaggatctatgcc
ctgatggagaaggattctctgccccgctttgtgcgctctgaattttataaggagctaatc
aagtag

DBGET integrated database retrieval system