KEGG   Mus musculus (mouse): 19739Help
Entry
19739             CDS       T01002                                 

Gene name
Rgs9, RGS9-1, Rgs9-2
Definition
(RefSeq) regulator of G-protein signaling 9
  KO
K13765  regulator of G-protein signaling 9
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04744  Phototransduction
mmu05030  Cocaine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    19739 (Rgs9)
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    19739 (Rgs9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RGS_DHEX RGS DEP G-gamma
Motif
Other DBs
NCBI-GeneID: 19739
NCBI-ProteinID: NP_035398
MGI: 1338824
Ensembl: ENSMUSG00000020599
Vega: OTTMUSG00000003137
UniProt: O54828
Structure
PDB: 

Position
11 E1; 11 71.86 cM
AA seq 675 aa AA seqDB search
MTIRHQGQQYRPRMAFLQKIEALVKDMQNPETGVRMHNQRVLVTSVPHAMTGGDVLQWIT
QRLWISNLEAQNLGNFIVKYGYIYPLQDPKNLILKPDSSLYRFQTPYFWPTQQWPAEDTD
YAIYLAKRNIKKKGILEEYEKENYDFLNKKINYKWDFVIMQAKEQYRTGKERNKADRYAL
DCQEKAYWLVHRSPPGMNNVLDYGLDRVTNPNEVKKQTVTAVRKEIMYYQQALMRSTVKS
SVSLGGIVKYSEQFSSNDAIMSGCLPSNPWITDDTQFWDLNAKLVEIPTKMRVERWAFNF
SELIRDPKGRQSFQYFLKKEFSGENLGFWEACEDLKYGDQSKVKEKAEEIYKLFLAPGAR
RWINIDGKTMDITVKGLRHPHRYVLDAAQTHIYMLMKKDSYARYLKSPIYKEMLAKAIEP
QETTKRSSTLPFMRRHLRSSPSPVILRQLEEEEKAREAANTVDITQPGQHLAPSPHLAVY
TGTCVPPSPSSPFSPSCRSPRKPFASPSRFIRRPSIAICPSPSRVALEGSSGLEPKGEAS
WSGANSGPSVTENREPSADHSRPQPRAPPKARAALSLGRFLRRGCLASPVFARLSPKCPS
VSHGKVQPLGDMGQQLPRLKPKKVANFFQIKMEMPTDSGTCLMDSDDPRAGESGDQTTEK
EVICPWESLAEGKAG
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgacgatccgacaccaaggccagcagtacaggccgaggatggcatttctccaaaagatc
gaagccctggtgaaggacatgcagaacccagagacgggagtcagaatgcataaccagaga
gtcctggtcaccagtgtccctcacgccatgacaggaggtgacgtgctgcagtggatcacc
cagcgcctttggatctctaacctggaggcacagaacctgggcaactttattgtcaagtat
ggctacatctatcctttgcaagaccccaagaatctcatcctcaagccggacagcagtctc
taccgatttcagacgccatatttctggcccacgcagcagtggccagctgaagacacagac
tacgccatctatctagcgaagcggaatatcaagaagaaggggattttagaagaatatgaa
aaggaaaattatgatttcttgaacaagaagattaattacaagtgggattttgtcatcatg
caggccaaagagcagtaccggactggaaaggaaaggaacaaagccgacaggtacgcgctg
gactgccaggagaaggcgtattggctggtgcaccgaagtccgcctggaatgaacaatgtg
ttagactacggcctggaccgcgtgaccaatccaaacgaagttaagaaacaaactgtcact
gctgtcagaaaagagatcatgtattaccaacaggccttaatgaggtccacagtgaagtct
tcggtgtctcttggaggaattgtcaagtacagcgagcagttctcgtccaatgacgccatc
atgtccggctgccttccaagcaatccttggataacagacgacacccagttctgggattta
aatgccaaattggtggagatcccaaccaagatgcgagtggagagatgggctttcaacttc
agcgaactgattcgagaccccaagggtcggcagagcttccagtactttctcaagaaggaa
tttagtggggagaacctaggattctgggaagcctgtgaggacctgaagtacggcgatcag
tccaaggtcaaggagaaagcagaggagatctacaagctgttcctggccccaggtgcgagg
cggtggatcaacatagacggcaaaaccatggacatcaccgtgaaggggctcagacacccc
caccgctatgtactggatgcagcgcagacccacatttacatgctcatgaagaaggattct
tacgcacgctatttgaaatctccaatctataaagaaatgctggccaaagctatcgagccc
caggaaaccaccaagagaagctccaccctcccatttatgaggcgtcacctacgctccagc
ccaagccctgtcattctgcggcagctggaagaagaagagaaagctcgagaagcagccaac
accgtggacatcacccagccaggtcagcacttggctcccagtcctcacctggccgtgtat
acagggacctgcgtgcctccctctccctccagtcccttctcaccatcctgccgctccccc
aggaagccctttgcttccccgagtcgcttcatccggcggcccagcattgccatctgcccc
tcgcccagccgagtggctttggagggttcttcgggactggagcccaagggggaagccagc
tggtctggcgccaactctgggccctcagtcactgagaacagagagccctctgcagaccac
tcaagaccccagcccagggcccctcccaaggcccgtgcagctctgtcccttggcaggttc
ctgagacggggctgtttggcatcaccagtttttgccaggctctcacccaagtgcccctct
gtgtcacacgggaaggtgcagcctctgggggacatgggccaacagctgcccaggctgaaa
cccaagaaagtagccaactttttccagatcaaaatggaaatgcctacagacagtgggacc
tgcctgatggactcggatgaccccagagcaggagagtctggtgaccagaccacagaaaaa
gaagtcatctgcccctgggagagcctggcggaagggaaggcgggctga

DBGET integrated database retrieval system