KEGG   Mus musculus (mouse): 19763Help
Entry
19763             CDS       T01002                                 

Gene name
Ring1, Ring1A
Definition
(RefSeq) ring finger protein 1
  KO
K10695  E3 ubiquitin-protein ligase RNF1/2 [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    19763 (Ring1)
   03036 Chromosome and associated proteins [BR:mmu03036]
    19763 (Ring1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     19763 (Ring1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    19763 (Ring1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     19763 (Ring1)
    AUTS2-polycomb complex
     19763 (Ring1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-RING_UBOX zf-RING_5 zf-C3HC4_4 zf-Nse zf-RING_6 zf-RING_4 zf-rbx1 Prok-RING_4 zf-C3HC4_5 zf-UDP zf-RING_11
Motif
Other DBs
NCBI-GeneID: 19763
NCBI-ProteinID: NP_033092
MGI: 1101770
Ensembl: ENSMUSG00000024325
Vega: OTTMUSG00000037105
UniProt: O35730
Position
17; 17 B1
AA seq 406 aa AA seqDB search
MTTPANAQNASKTWELSLYELHRTPQEAIMDGTEIAVSPRSLHSELMCPICLDMLKNTMT
TKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAH
QDRVLIRLSRLHNQQALSSSIEEGLRMQAMHRAQRVRRPMPGSDQTATMSGGEGEPGEGE
GDGEDVSSDSAPDSAPGPAPKRPRGAGAGASSVGTGGGAAGGACGGAGSEDSGDRGGTLG
GGTLGPPSPPGAPSPPEPGGEIELVFRPHPLLVEKGEYCQTRYVKTTGNATVDHLSKYLA
LRIALERRQQQETTEPGGPGGGASDTGGPDGGGGERGVAGGGEGPEEPALPSLEGVSEKQ
YTIYIAPGGGAFTTLNGSLTLELVNEKFWKVSRPLELCYAPTKDPK
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgccggcgaatgcacagaatgccagcaaaacgtgggaactgagtctctatgag
ctgcaccggaccccgcaggaagccatcatggatggtacagagattgcggtttcgcctcgg
tcactgcattctgagctcatgtgtcccatctgcctggacatgctgaagaacacaatgacc
accaaggagtgcctgcataggttctgctcggactgcatcgtcaccgccctgcggagcggg
aacaaggagtgccctacctgccggaaaaagctggtatccaagcggtccctacggccggac
cccaacttcgacgccctgatctccaaaatctaccctagccgggaggaatacgaggcccat
caggaccgggtgctcatccgcctcagccgcctgcacaaccagcaggcgctgagctccagt
atcgaggaagggctccggatgcaggccatgcacagggcccagcgtgtgaggcggccgatg
cctggatctgatcagaccgccacaatgagtgggggggaaggagaacctggggagggagaa
ggggatggagaggatgtaagctctgactccgccccagactctgctccaggccctgctccc
aagcgaccccgcggagcgggtgcaggggccagcagtgtagggacagggggtggggctgct
ggtggggcttgcgggggtgccggttctgaagactctggtgaccggggcggcaccctggga
gggggaaccctggggcccccaagccctcctggggcccccagccctccagagcccggtgga
gagattgagcttgtgttccggccccatcccctgcttgtggagaaaggagagtactgccag
actcggtacgtgaagactactgggaatgccacagtggatcatctctccaagtacctggcc
ctgcgcattgccctggagaggaggcagcagcaggaaaccacagagcccggagggcctggt
gggggtgcttcggacacaggcggacctgatgggggtggtggggagagaggcgttgccgga
ggaggcgaaggtcctgaggagcctgcgctgcccagcctggaaggtgtcagcgaaaagcag
tacaccatctacatcgctcctgggggcggagcgttcacgacgctgaatggatcactgacc
ttggagcttgtaaacgagaagttctggaaggtgtccaggcccttagagctctgctatgcc
cccacgaaggacccaaaatga

DBGET integrated database retrieval system