KEGG   Mus musculus (mouse): 19766Help
Entry
19766             CDS       T01002                                 

Gene name
Ripk1, D330015H01Rik, RIP, RIP-1, Rinp, Rip1
Definition
(RefSeq) receptor (TNFRSF)-interacting serine-threonine kinase 1
  KO
K02861  receptor-interacting serine/threonine-protein kinase 1 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
mmu04210  Apoptosis
mmu04217  Necroptosis
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04668  TNF signaling pathway
mmu05160  Hepatitis C
mmu05163  Human cytomegalovirus infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    19766 (Ripk1)
   04668 TNF signaling pathway
    19766 (Ripk1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    19766 (Ripk1)
   04217 Necroptosis
    19766 (Ripk1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    19766 (Ripk1)
   04621 NOD-like receptor signaling pathway
    19766 (Ripk1)
   04622 RIG-I-like receptor signaling pathway
    19766 (Ripk1)
   04623 Cytosolic DNA-sensing pathway
    19766 (Ripk1)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    19766 (Ripk1)
   05160 Hepatitis C
    19766 (Ripk1)
   05163 Human cytomegalovirus infection
    19766 (Ripk1)
   05169 Epstein-Barr virus infection
    19766 (Ripk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    19766 (Ripk1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     19766 (Ripk1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: TKL group
  RIPK family [OT]
   19766 (Ripk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Death RHIM Kinase-like Pkinase_fungal Kdo RIO1
Motif
Other DBs
NCBI-GeneID: 19766
NCBI-ProteinID: NP_033094
MGI: 108212
Ensembl: ENSMUSG00000021408
Vega: OTTMUSG00000035489
UniProt: Q60855
Position
13 A3.3; 13 14.01 cM
AA seq 656 aa AA seqDB search
MQPDMSLDNIKMASSDLLEKTDLDSGGFGKVSLCYHRSHGFVILKKVYTGPNRAEYNEVL
LEEGKMMHRLRHSRVVKLLGIIIEEGNYSLVMEYMEKGNLMHVLKTQIDVPLSLKGRIIV
EAIEGMCYLHDKGVIHKDLKPENILVDRDFHIKIADLGVASFKTWSKLTKEKDNKQKEVS
STTKKNNGGTLYYMAPEHLNDINAKPTEKSDVYSFGIVLWAIFAKKEPYENVICTEQFVI
CIKSGNRPNVEEILEYCPREIISLMERCWQAIPEDRPTFLGIEEEFRPFYLSHFEEYVEE
DVASLKKEYPDQSPVLQRMFSLQHDCVPLPPSRSNSEQPGSLHSSQGLQMGPVEESWFSS
SPEYPQDENDRSVQAKLQEEASYHAFGIFAEKQTKPQPRQNEAYNREEERKRRVSHDPFA
QQRARENIKSAGARGHSDPSTTSRGIAVQQLSWPATQTVWNNGLYNQHGFGTTGTGVWYP
PNLSQMYSTYKTPVPETNIPGSTPTMPYFSGPVADDLIKYTIFNSSGIQIGNHNYMDVGL
NSQPPNNTCKEESTSRHQAIFDNTTSLTDEHLNPIRENLGRQWKNCARKLGFTESQIDEI
DHDYERDGLKEKVYQMLQKWLMREGTKGATVGKLAQALHQCCRIDLLNHLIRASQS
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccagacatgtccttggacaatattaagatggcatccagtgacctgctggagaag
acagacctagacagcggaggcttcgggaaggtgtccttgtgttaccacagaagccatgga
tttgtcatcctgaaaaaagtatacacagggcccaaccgcgctgagtacaatgaggttctc
ttggaagaggggaagatgatgcacagactgagacacagtcgagtggtgaagctactgggc
atcatcatagaagaagggaactattcgctggtgatggagtacatggagaagggcaacctg
atgcacgtgctaaagacccagatagatgtcccactttcattgaaaggaaggataatcgtg
gaggccatagaaggcatgtgctacttacatgacaaaggtgtgatacacaaggacctgaag
cctgagaatatcctcgttgatcgtgactttcacattaagatagccgatcttggtgtggct
tcctttaagacatggagcaaactgactaaggagaaagacaacaagcagaaagaagtgagc
agcaccactaagaagaacaatggtggtaccctttactacatggcacccgaacacctgaat
gacatcaatgcaaagcccacggagaagtcggacgtgtacagctttggcattgtcctttgg
gcaatatttgcaaaaaaggagccctatgagaatgtcatctgtactgagcagttcgtgatc
tgcataaaatctgggaacaggccaaatgtagaggaaatccttgagtactgtccaagggag
atcatcagcctcatggagcggtgctggcaggcgatcccagaagacaggccaacatttctt
ggcattgaagaagaatttaggcctttttacttaagtcattttgaagaatatgtagaagag
gatgtggcaagtttaaagaaagagtatccagatcaaagcccagtgctgcagagaatgttt
tcactgcagcatgactgtgtacccttacctccgagcaggtcaaattcagaacaacctgga
tcgctgcacagttcccaggggctccagatgggtcctgtggaggagtcctggttttcttcc
tccccagagtacccacaggacgagaatgatcgcagtgtgcaggctaagctgcaagaggaa
gccagctatcatgcttttggaatatttgcagagaaacagacaaaaccgcagccaaggcag
aatgaggcttacaacagagaggaggaaaggaaacgaagggtctctcatgacccctttgca
cagcagagagctcgtgagaatattaagagtgcaggagcaagaggtcattctgatcccagc
acaacgagtcgtggaattgcagtgcaacagctgtcatggccagccacccaaacagtttgg
aacaatggattgtataatcagcatggatttggaactacaggtacaggagtttggtatccg
ccaaatctaagccaaatgtatagtacttataaaactccagtgccagagaccaacataccg
ggaagcacacccaccatgccatacttctctgggccagtagcagatgacctcataaaatat
actatattcaatagttctggtattcagattggaaaccacaattatatggatgttggactg
aattcacaaccaccaaacaatacttgcaaagaagagtcgacttccagacaccaagccatc
tttgataacaccactagtctgactgatgaacacctgaaccctatcagggaaaacctggga
aggcagtggaaaaactgtgcccgcaagctgggcttcactgagtctcagatcgatgaaatc
gaccatgactatgaaagagatggactgaaagagaaagtttaccaaatgcttcagaagtgg
ctgatgcgggaaggcaccaaaggggccacagtgggaaagttggcccaggcacttcaccaa
tgttgcaggatagacctgctgaaccacttgattcgtgccagccagagctaa

DBGET integrated database retrieval system