KEGG   Mus musculus (house mouse): 19775
Entry
19775             CDS       T01002                                 
Symbol
Xpr1, Rmc-1, Rmc1, Sxv, Syg1, XR
Name
(RefSeq) xenotropic and polytropic retrovirus receptor 1
  KO
K24195  xenotropic and polytropic retrovirus receptor 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    19775 (Xpr1)
Transporters [BR:mmu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   19775 (Xpr1)
SSDB
Motif
Pfam: EXS SPX
Other DBs
NCBI-GeneID: 19775
NCBI-ProteinID: NP_035403
MGI: 97932
Ensembl: ENSMUSG00000026469
UniProt: Q9Z0U0
Position
1:complement(155151403..155293190)
AA seq 695 aa
MKFAEHLSAHITPEWRKQYIQYEAFKDMLYSAQDQAPSVEVTDEDTVKRYFAKFEEKFFQ
TCEKELAKINTFYSEKLAEAQRRFATLQNELQSSLDVQKESSGVTTLRQRRKPVFHLSHE
ERVQHRNIKDLKLAFSEFYLSLILLQNYQNLNFTGFRKILKKHDKILETSRGADWRVIHV
EVAPFYTCKKINQLISETEAVVTNELEDGDRQKAMKRLRVPPLGAAQPAPAWTTFRVGLF
CGIFIVLNITLVFAAVFKLETDRTVWPLIRIYRGGFLLIEFLFLLGINTYGWRQAGVNHV
LIFELNPRNNLSHQHLFEIAGFLGILWCLSLLACFFAPISIIPIYVYPLALYGFMVFFLI
NPTKTFYYKSRFWLLKLLFRVFTAPFHKVGFADFWLADQLNSLSVILMDLEYMICFYSFE
LKWDESKGLLPNDPQEPEFCHKYSYGVRAIVQCIPAWLRFIQCLRRYRDTRRAFPHLVNA
GKYSTTFFTVTFAALYSTHEEQNHSDTVVFFYLWVFFCIISSCYTLIWDLKMDWGLFDKN
AGENTFLREEIVYPQKAYYYCAIIEDVILRFAWTIQISITATFKPHVGNIIATVFAPLEV
FRRFVWNFFRLENEHLNNCGEFRAVRDISVAPLNADDQTLLEQMMDQEDGVRNRQKNRSW
KYNQSISLRRPRLASQSKARDTKVLIEDTDDEANT
NT seq 2088 nt   +upstreamnt  +downstreamnt
atgaagttcgccgagcacctctccgcgcacatcactcccgagtggaggaagcagtacatc
cagtatgaggcattcaaggatatgctgtattcagctcaggaccaggcaccttcagttgaa
gttacagatgaggatacagttaagagatattttgccaagtttgaagaaaagtttttccaa
acctgtgaaaaggaacttgccaaaatcaacacattttattcagagaagctggcagaggct
cagcgcaggtttgctacacttcagaatgagcttcagtcatcgctggatgtgcagaaagaa
agcagtggtgtcacgacattgcgacagcgcagaaagccagtgttccacctgtcccacgag
gagcgtgtccaacataggaacattaaagaccttaagctggccttcagcgagttctacctc
agtctcatcctgctgcagaactatcagaatctgaattttacagggtttcggaaaatcctc
aaaaagcatgacaagatcctggaaacatctcgtggagcagattggcgagtgattcatgta
gaggtggccccattttatacatgcaagaaaattaaccagctcatttctgagactgaggct
gtggtcaccaatgaacttgaagatggtgacagacaaaaggctatgaagcggttacgggtc
cctccattgggagctgctcagcctgcaccagcatggactacttttagagttggcctattt
tgtggaatattcattgtgctgaatattacccttgtgtttgcagctgtatttaaacttgaa
acagatagaactgtatggcccttgataagaatctatcggggtggctttcttctgattgaa
ttcctttttctactgggcatcaacacatatggttggagacaagctggagtaaatcatgtc
ctcatctttgaacttaatccaagaaacaatttgtctcatcagcatctctttgagattgct
ggattcctggggatcttgtggtgcctgagccttctggcatgcttcttcgctccaattagt
atcatccctatatatgtgtatccactagccctttatgggtttatggtcttctttcttatc
aaccccaccaaaactttctactataaatccagattttggctgctcaaacttctgtttcga
gtatttactgctcccttccataaggtaggctttgctgatttctggctggccgatcagctg
aacagcctgtcagtgattctcatggacctggaatatatgatctgcttctacagttttgag
cttaaatgggatgagagtaagggcctgttgccaaatgatccacaagaaccagaattttgc
cacaaatattcatatggtgtgcgagccattgttcaatgtattccagcttggcttcgcttc
atccagtgcctgcgccggtaccgtgacacgaggagggcttttcctcatctagtaaatgct
ggcaaatactccacaactttcttcaccgtgacatttgcagccctttacagcactcacgaa
gaacaaaatcactctgacaccgtggtgttcttttacctgtgggtcttcttttgtatcatc
agttcctgctataccctcatctgggatctcaagatggactggggtctctttgataagaat
gcaggagaaaacactttcctccgggaagaaattgtataccctcaaaaagcctattactac
tgtgccatcatagaagatgtgatactgcgcttcgcttggactatccaaatctctattact
gctacgtttaagcctcatgttgggaacatcattgctactgtctttgccccccttgaggtt
ttccggcgatttgtgtggaacttcttccgtctggagaacgagcatctaaataactgtggt
gaattccgagccgtgcgggacatctctgtggcccccctcaacgcggatgaccagacacta
cttgagcagatgatggaccaggaggatggggttcgaaaccgccagaagaaccggtcgtgg
aagtacaatcagagcatatccctgcgtaggccccgcctggcttcccaatccaaggctcgc
gacactaaggtattgatagaagacacagatgacgaagctaacacttga

DBGET integrated database retrieval system