KEGG   Mus musculus (mouse): 19819
Entry
19819             CDS       T01002                                 

Gene name
Rnaseh1
Definition
(RefSeq) ribonuclease H1
  KO
K03469  ribonuclease HI [EC:3.1.26.4]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    19819 (Rnaseh1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    19819 (Rnaseh1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     19819 (Rnaseh1)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RNase H
    19819 (Rnaseh1)
 Prokaryotic type
   Elongation factors (bacterial)
    RNase H
     19819 (Rnaseh1)
   Elongation factors (archaeal)
     19819 (Rnaseh1)
SSDB
Motif
Pfam: RNase_H Cauli_VI RVT_3
Other DBs
NCBI-GeneID: 19819
NCBI-ProteinID: NP_001273794
MGI: 1335073
Ensembl: ENSMUSG00000020630
Position
12; 12 A2
AA seq 259 aa
MFYAVRRGRRTGVFLSWSECKAQVDRFPAARFKKFATEDEAWAFVRSSSSPDGSKGQESA
HEQKSQAKTSKRPREPLGEGEELPEPGPKHTRQDTEPSAVVSKDAFSYMGESVVVYTDGC
CSSNGRKRARAGIGVYWGPGHPLNVGIRLPGRQTNQRAEIHAACKAIMQAKAQNISKLVL
YTDSMFTINGITNWVQGWKKNGWRTSTGKDVINKEDFMELDELTQGMDIQWMHIPGHSGF
VGNEEADRLAREGAKQSED
NT seq 780 nt   +upstreamnt  +downstreamnt
atgttctatgcggtgaggagaggccgcaggaccggagtcttcctgagttggagtgagtgc
aaagcccaggtggaccggtttcctgctgccaggtttaagaaatttgccacagaagatgag
gcctgggcctttgtcaggagctcttcaagcccggatggttcaaaagggcaggaaagtgca
catgagcagaagtcacaggcgaagaccagcaagcggcctcgggagcccctgggtgaaggg
gaagaacttccagagccagggccgaagcacacacgacaggacaccgagccctcggctgta
gtgagcaaggacgcattttcttatatgggagagtcagtcgttgtctacacggatggctgt
tgctccagtaatggacggaagcgggcacgagcaggaattggcgtttactggggcccaggc
caccccttaaatgtaggtataaggcttcctgggcgacagacaaaccagagggccgagatc
catgcagcctgcaaggccatcatgcaagccaaggctcagaacatcagcaagctggttctg
tacacagacagcatgttcaccatcaatgggataactaactgggttcagggctggaagaag
aatggctggagaacaagtacagggaaagatgtgatcaacaaggaggacttcatggagctg
gacgagctcactcagggcatggacatccagtggatgcacattcctggtcactcaggattt
gtgggcaatgaagaggccgacagactggcacgggaaggagcgaagcagtctgaggactga

DBGET integrated database retrieval system