KEGG   Mus musculus (mouse): 19821
Entry
19821             CDS       T01002                                 

Gene name
Rnf2, AI326319, AI450156, AU019207, Rin, Ring1B, di, dinG
Definition
(RefSeq) ring finger protein 2
  KO
K10695  E3 ubiquitin-protein ligase RNF1/2 [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    19821 (Rnf2)
   03036 Chromosome and associated proteins [BR:mmu03036]
    19821 (Rnf2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     19821 (Rnf2)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    19821 (Rnf2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     19821 (Rnf2)
    AUTS2-polycomb complex
     19821 (Rnf2)
SSDB
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-RING_UBOX zf-RING_5 zf-C3HC4_4 zf-Nse zf-RING_4 zf-RING_6 zf-rbx1 zf-C3HC4_5 zf-UDP zf-ANAPC11 zf-RING_11
Other DBs
NCBI-GeneID: 19821
NCBI-ProteinID: NP_035407
MGI: 1101759
Ensembl: ENSMUSG00000026484
Vega: OTTMUSG00000049593
UniProt: Q9CQJ4
Structure
PDB: 
2CKL

Position
1; 1 G1
AA seq 336 aa
MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKN
TMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEY
EAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCS
NASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAVAIDPVMDGASEIELVFRPHPTLMEKD
DSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASG
QFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgtctcaggctgtgcagacaaatggaactcaaccattaagcaaaacatgggaactcagt
ttgtatgagttacaacgaacacctcaggaggcaataacagatggcttggaaattgtggtt
tcacctagaagtctacacagtgaattaatgtgcccaatttgtttggatatgttaaagaac
accatgactacaaaggagtgtttacatcggttttgcgcggattgtattatcacagccctt
agaagtggcaacaaagagtgtcctacctgtcggaaaaaactggtttctaaaagatcacta
aggccagacccgaactttgatgcactcatcagcaagatttatcccagtcgtgatgagtat
gaagcgcatcaggaaagggtcttagcaaggatcaacaaacacaacaatcagcaggctctc
agccacagcatcgaggaggggctgaagatacaggccatgaacagattacagcgaggcaaa
aagcagcagatagaaaatggtagtggagcagaagataatggtgacagctcccactgtagt
aacgcatccacacacagcaaccaggaagcgggcccgagtaacaaacggaccaaaacctct
gatgactctgggcttgaacttgataacaacaatgcagcagtggcgattgatccagtcatg
gacggtgccagtgagattgagttagtcttcaggccccatccaactcttatggaaaaggac
gacagcgcacagacaagatacataaagacttcaggcaatgccactgttgatcacttatcc
aagtatctggctgtgaggttagctttagaagaacttcgaagcaaaggagaatcaaaccag
atgaacctggatacagccagtgagaagcagtacaccatttacatagccacagccagtggc
cagttcaccgttttaaatggctccttttctttggaattggtcagtgagaaatactggaaa
gtgaacaaacccatggaactttattatgcacccaccaaggagcacaaatga

DBGET integrated database retrieval system