KEGG   Mus musculus (mouse): 19823
Entry
19823             CDS       T01002                                 

Gene name
Rnf7, Rbx, Rbx2, S, SAG
Definition
(RefSeq) ring finger protein 7
  KO
K10611  RING-box protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
mmu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    19823 (Rnf7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    19823 (Rnf7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    19823 (Rnf7)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Ring finger protein
     19823 (Rnf7)
SSDB
Motif
Pfam: zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4_3 zf-C3HC4
Other DBs
NCBI-GeneID: 19823
NCBI-ProteinID: NP_035409
MGI: 1337096
Ensembl: ENSMUSG00000051234
Vega: OTTMUSG00000022972
UniProt: Q9WTZ1
Position
9; 9 E3.3
AA seq 113 aa
MADVEDGEEPCVLSSHSGSAGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDA
CLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK
NT seq 342 nt   +upstreamnt  +downstreamnt
atggccgacgtggaggacggcgaggaaccctgcgtcctttcttcgcactccgggagcgca
ggctccaagtcgggaggcgacaagatgttctctctcaagaagtggaacgcggtagccatg
tggagctgggacgttgagtgcgatacctgtgccatctgcagggtccaggtgatggatgcc
tgccttcgatgtcaagctgaaaacaagcaagaggactgtgttgtggtctggggagagtgt
aaccattccttccacaactgctgcatgtccctgtgggtgaaacagaacaatcgctgccct
ctgtgccagcaggactgggtagtccaaagaatcggcaaatga

DBGET integrated database retrieval system