KEGG   Mus musculus (house mouse): 19876
Entry
19876             CDS       T01002                                 
Symbol
Robo1, DUTT1, Gm310
Name
(RefSeq) roundabout guidance receptor 1
  KO
K06753  roundabout, axon guidance receptor 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    19876 (Robo1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    19876 (Robo1)
Cell adhesion molecules [BR:mmu04515]
 Immunoglobulin superfamily
  ROBO family
   19876 (Robo1)
SSDB
Motif
Pfam: I-set Ig_3 Ig_2 ig fn3 V-set C2-set_2 Pur_ac_phosph_N Big_4
Other DBs
NCBI-GeneID: 19876
NCBI-ProteinID: NP_062286
MGI: 1274781
Ensembl: ENSMUSG00000022883
UniProt: O89026 G5E843 Q3UXH3 Q3UQ03
Position
16:71824406..72844379
AA seq 1612 aa
MIAEPARFYLFGLICLCSGSRLRQEDFPPRIVEHPSDLIVSKGEPATLNCKAEGRPTPTI
EWYKGGERVETDKDDPRSHRMLLPSGSLFFLRIVHGRKSRPDEGVYICVARNYLGEAVSH
NASLEVAILRDDFRQNPSDVMVAVGEPAVMECQPPRGHPEPTISWKKDGSPLDDKDERIT
IRGGKLMITYTRKSDAGKYVCVGTNMVGERESEVAELTVLERPSFVKRPSNLAVTVDDSA
EFKCEARGDPVPTVRWRKDDGELPKSRYEIRDDHTLKIRKVTAGDMGSYTCVAENMVGKA
EASATLTVQEPPHFVVKPRDQVVALGRTVTFQCEATGNPQPAIFWRREGSQNLLFSYQPP
QSSSRFSVSQTGDLTITNVQRSDVGYYICQTLNVAGSIITKAYLEVTDVIADRPPPVIRQ
GPVNQTVAVDGTLILSCVATGSPAPTILWRKDGVLVSTQDSRIKQLESGVLQIRYAKLGD
TGRYTCTASTPSGEATWSAYIEVQEFGVPVQPPRPTDPNLIPSAPSKPEVTDVSKNTVTL
SWQPNLNSGATPTSYIIEAFSHASGSSWQTAAENVKTETFAIKGLKPNAIYLFLVRAANA
YGISDPSQISDPVKTQDVPPTSQGVDHKQVQRELGNVVLHLHNPTILSSSSVEVHWTVDQ
QSQYIQGYKILYRPSGASHGESEWLVFEVRTPTKNSVVIPDLRKGVNYEIKARPFFNEFQ
GADSEIKFAKTLEEAPSAPPRSVTVSKNDGNGTAILVTWQPPPEDTQNGMVQEYKVWCLG
NETKYHINKTVDGSTFSVVIPSLVPGIRYSVEVAASTGAGPGVKSEPQFIQLDSHGNPVS
PEDQVSLAQQISDVVRQPAFIAGIGAACWIILMVFSIWLYRHRKKRNGLTSTYAGIRKVP
SFTFTPTVTYQRGGEAVSSGGRPGLLNISEPATQPWLADTWPNTGNNHNDCSINCCTAGN
GNSDSNLTTYSRPADCIANYNNQLDNKQTNLMLPESTVYGDVDLSNKINEMKTFNSPNLK
DGRFVNPSGQPTPYATTQLIQANLSNNMNNGAGDSSEKHWKPPGQQKPEVAPIQYNIMEQ
NKLNKDYRANDTIPPTIPYNQSYDQNTGGSYNSSDRGSSTSGSQGHKKGARTPKAPKQGG
MNWADLLPPPPAHPPPHSNSEEYNMSVDESYDQEMPCPVPPARMYLQQDELEEEEDERGP
TPPVRGAASSPAAVSYSHQSTATLTPSPQEELQPMLQDCPEDLGHMPHPPDRRRQPVSPP
PPPRPISPPHTYGYISGPLVSDMDTDAPEEEEDEADMEVAKMQTRRLLLRGLEQTPASSV
GDLESSVTGSMINGWGSASEEDNISSGRSSVSSSDGSFFTDADFAQAVAAAAEYAGLKVA
RRQMQDAAGRRHFHASQCPRPTSPVSTDSNMSAVVIQKARPAKKQKHQPGHLRREAYADD
LPPPPVPPPAIKSPTVQSKAQLEVRPVMVPKLASIEARTDRSSDRKGGSYKGREALDGRQ
VTDLRTNPSDPREAQEQPNDGKGRGTKAAKRDLPPAKTHLGQEDILPYCRPTFPTSNNPR
DPSSSSSMSSRGSGSRQREQANVGRRNMAEMQVLGGFERGDENNEELEETES
NT seq 4839 nt   +upstreamnt  +downstreamnt
atgatcgcggagcctgctcgcttttacctctttggattaatatgtctctgttcaggctcc
cgtcttcgtcaggaagattttccaccccgcattgttgaacacccttcagacctgatcgtc
tccaaaggagaacctgccactctgaactgtaaagccgaaggccgccccaccccgacgata
gaatggtacaaaggtggggaaagagtggagacggacaaagatgacccgcgctcacaccgg
atgctgctgccaagcgggtctttatttttcttacgcatagtccatggacggaagagtagg
cccgacgaaggggtctacatctgtgtggctaggaattacctcggagaggctgtgagccac
aacgcatcgctggaggtagctatactacgggatgacttcagacaaaacccttcagatgtc
atggtggcagtaggcgaacctgcagtcatggaatgccagcctccacggggccatccagag
cccaccatctcctggaaaaaggatggctcacccctggatgataaagatgaaagaatcact
atacgaggaggaaaactcatgatcacttatacgcgtaaaagcgatgctggcaagtatgtt
tgcgttggcaccaacatggtgggggaacgggagagtgaagtcgcagagctaaccgtttta
gagagaccatcgtttgtgaagagacccagtaatttggcagtgactgtggatgacagtgca
gaatttaaatgtgaggcccgaggagaccctgtgcctacagttcgatggaggaaagatgac
ggagagctgcccaaatccagatatgaaatccgagatgatcatactttgaaaattcggaag
gtgactgctggcgacatgggatcatacacttgtgtggcagaaaatatggtcgggaaagct
gaagcttccgctactttgacagttcaagagccgccacatttcgttgtaaaacctcgggac
caggtggttgccttgggaagaactgtgacgtttcagtgcgaagcaactggaaatcctcaa
ccagctatcttttggaggagagaggggagtcagaatctacttttctcctaccagcctcca
cagtcctctagccgattttcagtttcgcagacaggagacctcaccattacgaacgtccag
cggtctgatgtcggctactacatctgtcagactttaaatgttgctggaagtatcatcaca
aaggcctatttggaagttactgatgtgattgcagaccggcctcccccagtcattcggcaa
ggtcctgtgaatcagactgtagcagtggatggcactttaatcctcagctgtgtggccaca
ggcagtccagcacccacaattctgtggaggaaggatggagtccttgtttcaacccaagat
tctcggatcaaacagctggagagtggcgtgctgcagatccgctacgctaagctgggtgac
acgggtcggtacacctgcaccgcatcgacccccagcggtgaggccacgtggagcgcttac
atcgaagtccaggaatttggggttccagttcaacccccaagacccaccgaccccaactta
atccccagcgccccctcaaagcccgaagttacagatgtcagcaaaaacacggtcacttta
tcgtggcagccaaacttgaactcaggagcaaccccaacatcttatattatagaagccttc
agccatgcatctggtagcagctggcagacggcggcagaaaatgtgaaaacagaaacattt
gccatcaaaggactcaaacctaacgccatttaccttttcctggtgagggcagcaaatgcc
tatggaattagtgatccaagccaaatatcagatccagtgaaaacgcaagatgtcccacca
accagccaaggggtggaccacaagcaggtccaaagagaactggggaatgttgtcttacat
ctgcacaacccgaccatcctttcttcctcctcagtcgaagtgcactggacggtggaccaa
caatctcaatatattcaaggctataaaattctctaccgcccatctggagccagccatggt
gaatcggagtggttagtttttgaagtgaggacgccaacgaaaaacagcgtggtgatcccc
gatctcagaaaaggcgtcaactacgagattaaggctcgcccattttttaatgagtttcaa
ggagcagacagtgaaatcaaatttgccaaaaccttagaagaagcaccaagtgcccctccc
cgaagtgtaactgtatccaagaatgatggaaatgggactgcaatcctggtcacttggcaa
ccgcctcctgaagacacacaaaatggaatggtccaagaatataaggtttggtgtctcggt
aatgaaacgaagtatcacataaacaagacagtcgatggctcgaccttctcggtggtcatc
ccctctctggttcctgggatccgatacagtgtggaggtggcagcgagcactggggcgggt
cccggggtgaagagcgaacctcagttcatccagttagattctcacggaaaccccgtgtct
cccgaggaccaagtcagccttgctcagcagatctccgacgtggtgaggcagccggcgttc
attgcaggcattggggcagcctgttggattatcctcatggtcttcagcatctggctttac
agacaccgcaagaagagaaacggactcaccagcacgtatgcgggtatccggaaagtcccg
tcctttaccttcacgccaacagtaacttatcaaagaggaggcgaagccgtcagcagtgga
gggaggccgggactcctcaacattagtgaacctgccacgcagccatggctggcagacacg
tggcccaacacaggcaacaaccacaatgactgctccatcaactgctgcacggccggcaat
ggcaacagcgacagcaacctgacaacctacagtcgcccagctgattgtatagccaattat
aacaaccaactggataacaaacaaacaaatctgatgctccctgagtcaactgtttatggt
gatgtggaccttagtaacaaaatcaatgagatgaaaaccttcaatagcccaaatctgaag
gacgggcgttttgtcaatccatcagggcagcccactccctatgccaccactcaactcatc
caggcgaacctcagcaacaatatgaataatggcgccggggactccagcgagaagcactgg
aagcctccgggacagcagaaaccggaagtggcaccaattcagtataacatcatggagcaa
aacaagctgaacaaagattatcgggcaaatgacacgatccctccaaccatcccatacaac
cagtcctatgaccagaacacaggagggtcttataacagctcagatcggggcagtagtaca
tccgggagtcaaggccacaagaaaggggcacggacaccaaaggcacccaagcagggtggc
atgaactgggcagacttgctgccccctcctccggcgcatcctcccccacatagcaacagt
gaagaatacaacatgtccgtagatgaaagctatgatcaagaaatgccctgtccagtgcca
cctgcgcggatgtatttgcaacaggatgaattagaggaagaggaagatgaaagaggcccc
actccccctgtccggggggcagcttcttctccagctgctgtgtcctacagccaccaatcc
acggccactctcaccccttctccccaggaagagctccagcccatgttacaggattgtccg
gaggacctcgggcacatgccccacccaccagacaggaggcggcagcccgtgagtcctcct
ccaccgccacggccaatttccccacctcatacttacggctacatttcaggaccccttgtc
tcagatatggataccgatgccccagaagaggaggaggacgaagctgacatggaagttgcc
aaaatgcagacccgaaggctgttgttacgtgggctggagcagaccccagcatccagtgtt
ggggaccttgagagctccgtcactgggtccatgatcaatggctggggctcagcctcggaa
gaggacaacatttccagtgggcgctccagtgtcagttcatccgatggctcctttttcact
gacgctgattttgcccaggcagttgctgcagctgcggagtatgcgggcctgaaagtggct
cgccgccaaatgcaagatgctgctggccgccgccacttccatgcctctcagtgcccaagg
cccacgagtcctgtgtccacagacagcaacatgagtgctgttgtgatccagaaagccaga
cccgccaagaagcagaaacaccagccaggacatctgcgcagggaagcctacgcagatgat
cttccaccccctccagtgccaccacctgctataaaatcgcccactgtccagtccaaggca
cagctggaggtacggcctgtcatggtgccaaaactcgcgtctatagaagcaaggacagat
agatcgtcagacagaaaaggaggcagttacaaggggagagaagctctggatggaagacaa
gtcactgacctgcgaacaaatccaagtgaccccagagaggcacaggaacagccaaatgac
gggaaaggccgaggaacaaaggcagccaagcgagaccttccaccagcaaagacgcacctc
ggccaagaggatattcttccgtactgtagacctactttcccaacgtcaaacaaccctaga
gaccccagttcctccagctctatgtcatcaagaggatcagggagccgacaaagagagcaa
gcaaatgtgggccgaaggaatatggcagaaatgcaagtacttgggggatttgaaagagga
gatgagaataatgaagaattagaggaaactgaaagctga

DBGET integrated database retrieval system