KEGG   Mus musculus (mouse): 19878Help
Entry
19878             CDS       T01002                                 

Gene name
Rock2, B230113H15Rik, ROKalpha, Rho-kinase, Rock-II, Rock2m, mKIAA0619
Definition
(RefSeq) Rho-associated coiled-coil containing protein kinase 2
  KO
K17388  Rho-associated protein kinase 2 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04270  Vascular smooth muscle contraction
mmu04310  Wnt signaling pathway
mmu04360  Axon guidance
mmu04510  Focal adhesion
mmu04530  Tight junction
mmu04611  Platelet activation
mmu04670  Leukocyte transendothelial migration
mmu04810  Regulation of actin cytoskeleton
mmu04921  Oxytocin signaling pathway
mmu05132  Salmonella infection
mmu05135  Yersinia infection
mmu05163  Human cytomegalovirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    19878 (Rock2)
   04071 Sphingolipid signaling pathway
    19878 (Rock2)
   04024 cAMP signaling pathway
    19878 (Rock2)
   04022 cGMP-PKG signaling pathway
    19878 (Rock2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    19878 (Rock2)
   04530 Tight junction
    19878 (Rock2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    19878 (Rock2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    19878 (Rock2)
   04670 Leukocyte transendothelial migration
    19878 (Rock2)
   04062 Chemokine signaling pathway
    19878 (Rock2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    19878 (Rock2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    19878 (Rock2)
  09158 Development and regeneration
   04360 Axon guidance
    19878 (Rock2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    19878 (Rock2)
   05205 Proteoglycans in cancer
    19878 (Rock2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    19878 (Rock2)
   05135 Yersinia infection
    19878 (Rock2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    19878 (Rock2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    19878 (Rock2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    19878 (Rock2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     19878 (Rock2)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   19878 (Rock2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    19878 (Rock2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding PH C1_1 APH
Motif
Other DBs
NCBI-GeneID: 19878
NCBI-ProteinID: NP_033098
MGI: 107926
Ensembl: ENSMUSG00000020580
UniProt: P70336 F8VPK5 Q3TR46
Position
12; 12 A1.1
AA seq 1388 aa AA seqDB search
MSRPPPTGKMPGAPETAPGDGAGAGRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFP
ALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAM
KLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFCAFQDDRYLYMVMEYMPGGDLVNL
MSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMD
ETGMVHCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLFEMLVGDTPFYADSLV
GTYSKIMDHKNSLCFPEDTEISKHAKNLICAFLTDREVRLGRNGVEEIKQHPFFKNDQWN
WDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYFRENL
LLSDSPPCRENDAIQTRKSEESQEIQKKLYALEEHLSSEVQAKEELEQKCKSINTRLEKT
AKELEEEITLRKSVESTLRQLEREKALLQHKNAEYQRKADHEADKKRNLENDVNSLKDQL
EDLKKRNQSSQISTEKVNQLQKQLDEANALLRTESDTAARLRKTQAESSKQIQQLESNNR
DLQDKNCLLETAKLKLEKEFINLQSALESERRDRTHGSEIINDLQGRISGLEEDLKTGKA
LLAKVELEKRQLQEKLTDLEKEKSNMEIDMTYQLKVIQQSLEQEEAEHKTTKARLADKNK
IYESIEEAKSEAMKEMEKKLLEERSLKQKVENLLLEAEKRCSILDCDLKQSQQKLNELLK
QKDVLNEDVRNLTLKIEQETQKRCLMQNDLKMQTQQVNTLKMSEKQIKQENNHLMEMKMN
LEKQNTELRKERQDADGQMKELQDQLEAEQYFSTLYKTQVRELKEENEEKTKLCKELQQK
KQDLQDERDSLAAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMKELEIKEMMARHKQE
LTEKDTTIASLEETNRTLTSDVANLANEKEELNNKLKDSQEQLSKLKDEEMSAAAIKAQF
EKQLLNERTLKTQAVNKLAEIMNRKEPVKRGSDTDVRRKEKENRKLHMELKSEREKLTQQ
MIKYQKELNEMQAQIAEESQIRIELQMTLDSKDSDIEQLRSQLQALHIGMDSSSIGSGPG
DAEPDDGFPESRLEGWLSLPVRNNTKKFGWVKKYVIVSSKKILFYDSEQDKEQSNPYMVL
DIDKLFHVRPVTQTDVYRADAKEIPRIFQILYANEGESKKEPEFPVEPVGEKSNYICHKG
HEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYD
ISSAKNLLLLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSR
QLAPNKPS
NT seq 4167 nt NT seq  +upstreamnt  +downstreamnt
atgagccggcccccgccgacggggaaaatgcccggcgcccccgagaccgcgccgggggac
ggggcgggcgccggccgtcagaggaagctggaggcgctcatccgagaccctcgctcgccc
atcaacgtggagagtctgctggatggcttaaattccttggtccttgatttggattttcct
gctttgaggaaaaataaaaatatagataacttcttaaatagatatgagaaaattgtgaaa
aaaatcagaggtttacagatgaaagcggaagactatgatgttgtaaaagttattggaaga
ggtgcttttggtgaagttcagttggttcgtcataaggcatcacagaaggtttatgcaatg
aagcttcttagtaaatttgaaatgataaaaagatcagattctgcttttttctgggaagaa
agagatattatggcctttgccaacagtccctgggtagttcagctcttctgtgcctttcaa
gatgacaggtacctgtacatggtgatggagtacatgccaggcggagacctcgtcaacctt
atgagtaattatgatgtacctgaaaagtgggccaagttttacactgctgaagtagtgctt
gcactggatgcaatacactccatgggcttaatacacagagatgtgaagcctgataacatg
ctattggataaacatggacatctaaagttagcagattttggcacatgtatgaaaatggat
gaaacaggcatggtgcattgcgacacagcagttggaactcccgactacatatcgcccgag
gttctgaaatcacaaggaggtgatggttactatgggcgagaatgtgattggtggtctgta
ggtgttttcctttttgagatgttagtaggggacactccattttacgcagattcacttgta
ggaacctacagcaaaattatggatcataaaaattcactgtgttttcctgaagatacagaa
atttctaaacatgcgaagaatctcatatgtgccttcttaacagacagggaggtacgactt
ggaagaaatggggtagaagaaatcaaacagcatcctttctttaagaatgatcaatggaat
tgggataacataagagagacggcagctccagtggtacctgagctcagcagtgacatagac
agcagcaactttgacgacattgaggatgacaaaggcgatgtagagaccttcccgattcct
aaagcttttgtgggaaatcagctgccttttataggatttacctactttagagaaaatttg
ttattaagtgactctccaccttgtagagaaaatgatgcaatacaaacaaggaaaagtgaa
gaaagtcaggagattcagaaaaaattatatgcactagaagaacaccttagcagtgaggtg
caagccaaggaggagctggaacagaagtgcaaatctattaatactcgcctagagaaaaca
gcaaaggagctagaagaagagattaccttacggaaaagtgtggaatcaacattaagacag
ctggaaagagaaaaggcccttcttcagcacaaaaatgcagagtatcagcggaaagctgat
catgaagccgacaagaagcggaacttggaaaatgatgttaacagcttaaaagatcaactt
gaagatctgaagaaaaggaaccagagctctcagatatccactgagaaggtcaatcagctc
cagaaacaactggatgaagctaatgctttgctgagaacagagtctgatactgcagcacgg
ttaagaaaaacccaggcagaaagttccaaacagattcagcagctggaatctaacaataga
gatctacaagataaaaactgcctgcttgagactgccaagttaaaacttgaaaaggaattt
atcaatcttcagtcagctttagaatctgaaagaagggaccggacccatggatcagagata
attaatgatttacaaggtagaatatctgggttggaagaagatttgaagactggcaaagcc
ttactagcaaaagtagagctggagaagagacagctgcaggagaagctcactgacttagag
aaggaaaaaagcaacatggaaatagatatgacatatcaactgaaagttatacagcagagt
ttagaacaagaagaagctgaacacaagaccacaaaagcacggctagcggataaaaataag
atctatgaatccattgaagaagctaaatcagaagccatgaaagaaatggagaagaagctg
ttggaagagaggtctttaaagcagaaagtggagaacctgctcctggaagccgagaaaaga
tgctctatattggactgtgacctcaaacagtctcagcagaagctaaatgagctgctgaag
cagaaagatgtgctgaacgaggatgttagaaatttgacattaaaaatagagcaggaaact
cagaagcgttgtcttatgcaaaatgacctgaagatgcagacccaacaagttaacacccta
aaaatgtcagaaaagcaaataaaacaagaaaataatcatcttatggaaatgaaaatgaac
ttggaaaagcaaaatactgaacttcgaaaagagcggcaggatgcagatgggcagatgaag
gaactgcaagaccaacttgaagcagagcagtatttctcaaccctctataaaacacaagtt
agagaacttaaagaagaaaatgaagagaagacaaaactttgtaaagagttgcaacagaag
aagcaggatttacaggatgaaagagactctttggctgcccagctggaaattacccttacc
aaagcagattctgagcagctggctcgttccattgctgaagaacaatactctgatttggaa
aaagagaagatcatgaaagagctggagatcaaagagatgatggctagacacaaacaagaa
cttactgaaaaggatactacaattgcatctcttgaagaaacaaataggacactaactagc
gatgttgcaaatcttgcaaatgagaaagaagaattaaacaacaagctgaaagatagccaa
gaacaactgtccaagttgaaagatgaagagatgagtgcagcagctattaaagcacagttt
gagaagcagcttctgaatgagagaactctcaagactcaagctgtgaataagttggcggag
atcatgaatcgaaaagaacctgtcaagcgtggtagtgacacagatgtgcgaagaaaagag
aaggaaaacagaaagctacatatggagcttaagtctgaacgtgaaaaattgacacaacag
atgatcaaatatcagaaagaactgaatgaaatgcaggctcaaatagctgaagagagccaa
attcgaatagaactccagatgaccctggacagtaaagacagcgacattgaacagctgcgg
tcacagctccaggccttgcatattggtatggacagttccagtataggcagtggaccaggc
gatgctgagcctgatgatggatttccagaatcaagattagaaggatggttgtcattgcct
gtgcgcaacaacactaaaaagtttggatgggttaaaaagtatgtgattgtaagcagcaag
aagattcttttttatgacagcgaacaagataaagagcagtccaacccttacatggtgtta
gacatagacaagctatttcacgtccgacctgttacccagacagatgtatacagagcagat
gctaaagaaattccaaggatatttcagattctatatgccaatgaaggagaaagtaagaag
gaaccagagtttccagtggaaccagtgggagaaaaatctaattatatttgtcacaaagga
catgagtttattcctactctttatcacttcccaaccaactgtgaggcatgtatgaagccg
ctgtggcacatgtttaagcctcctcctgctctagagtgccgtaggtgccacattaaatgt
cataaagatcacatggacaagaaggaagagattatagcgccctgcaaagtttattatgat
atatcgtcggcaaagaatctgttgttattagcaaattcaacagaagaacagcagaaatgg
gttagtcggttggtgaaaaagatacctaaaaagcctccagctccagacccttttgcccga
tcatcccctagaacttcaatgaaaatacaacaaaaccagtccattcggcggcccagtcga
cagcttgctccaaacaagccaagctaa

DBGET integrated database retrieval system