KEGG   Mus musculus (mouse): 19885
Entry
19885             CDS       T01002                                 

Symbol
Rorc, Nr1f3, RORgamma, TOR, Thor
Name
(RefSeq) RAR-related orphan receptor gamma
  KO
K08534  RAR-related orphan receptor gamma
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04659  Th17 cell differentiation
mmu04710  Circadian rhythm
mmu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    19885 (Rorc)
  09159 Environmental adaptation
   04710 Circadian rhythm
    19885 (Rorc)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    19885 (Rorc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    19885 (Rorc)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mmu03310]
    19885 (Rorc)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    19885 (Rorc)
Nuclear receptors [BR:mmu03310]
 1. Thyroid hormone like
  1F. RAR-related orphan receptor
   19885 (Rorc)
SSDB
Motif
Pfam: zf-C4 Hormone_recep Emfourin
Other DBs
NCBI-GeneID: 19885
NCBI-ProteinID: NP_035411
MGI: 104856
Ensembl: ENSMUSG00000028150
Vega: OTTMUSG00000022692
UniProt: P51450 A0A0R4J096
Position
3; 3 F2.1
AA seq 516 aa
MDRAPQRHHRTSRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQ
CNVAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQK
QLQQQQQQEQVAKTPPAGSRGADTLTYTLGLSDGQLPLGASPDLPEASACPPGLLRASGS
GPPYSNTLAKTEVQGASCHLEYSPERGKAEGRDSIYSTDGQLTLGRCGLRFEETRHPELG
EPEQGPDSHCIPSFCSAPEVPYASLTDIEYLVQNVCKSFRETCQLRLEDLLRQRTNLFSR
EEVTSYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIILLKAGAMEVVL
VRMCRAYNANNHTVFFEGKYGGVELFRALGCSELISSIFDFSHFLSALCFSEDEIALYTA
LVLINANRPGLQEKRRVEHLQYNLELAFHHHLCKTHRQGLLAKLPPKGKLRSLCSQHVEK
LQIFQHLHPIVVQAAFPPLYKELFSTDVESPEGLSK
NT seq 1551 nt   +upstreamnt  +downstreamnt
atggacagggccccacagagacaccaccggacatctcgggagctgctggctgcaaagaag
acccacacctcacaaattgaagtgatcccttgcaagatctgtggggacaagtcatctggg
atccactacggggttatcacctgtgaggggtgcaagggcttcttccgccgcagccagcag
tgtaatgtggcctactcctgcacgcgtcagcagaactgccccattgaccgaaccagccgc
aaccgatgccagcattgccgcctgcagaagtgcctggctctgggcatgtcccgagatgct
gtcaagtttggccgaatgtccaagaagcagagggacagtctacatgcagaagtgcagaaa
caactgcaacagcagcagcaacaggaacaagtggccaagactcctccagctgggagccgc
ggagcagacacacttacatacactttagggctctcagatgggcagctaccactgggcgcc
tcacctgacctacccgaggcctctgcttgtccccctggcctcctgagagcctcaggctct
ggcccaccatattccaataccttggccaaaacagaggtccagggggcctcctgccacctt
gagtatagtccagaacgaggcaaagctgaaggcagagacagcatctatagcactgacggc
caacttactcttggaagatgtggacttcgttttgaggaaaccaggcatcctgaacttggg
gaaccagaacagggtccagacagccactgcattcccagtttctgcagtgccccagaggta
ccatatgcctctctgacagacatagagtacctggtacagaatgtctgcaagtccttccga
gagacatgccagctgcgactggaggaccttctacggcagcgcaccaacctcttttcacgg
gaggaggtgaccagctaccagaggaagtcaatgtgggagatgtgggagcgctgtgcccac
cacctcactgaggccattcagtatgtggtggagtttgccaagcggctttcaggcttcatg
gagctctgccagaatgaccagatcatactactgaaagcaggagcaatggaagtcgtccta
gtcagaatgtgcagggcctacaatgccaacaaccacacagtcttttttgaaggcaaatac
ggtggtgtggagctgtttcgagccttgggctgcagcgagctcatcagctccatatttgac
ttttcccacttcctcagcgccctgtgtttttctgaggatgagattgccctctacacggcc
ctggttctcatcaatgccaaccgtcctgggctccaagagaagaggagagtggaacatctg
caatacaatttggaactggctttccatcatcatctctgcaagactcatcgacaaggcctc
ctagccaagctgccacccaaaggaaaactccggagcctgtgcagccaacatgtggaaaag
ctgcagatcttccagcacctccaccccatcgtggtccaagccgccttccctccactctat
aaggaactcttcagcactgatgttgaatcccctgaggggctgtcaaagtga

DBGET integrated database retrieval system