KEGG   Mus musculus (mouse): 19886Help
Entry
19886             CDS       T01002                                 

Gene name
Ros1, Ros-1, c-ros
Definition
(RefSeq) Ros1 proto-oncogene
  KO
K05088  proto-oncogene tyrosine-protein kinase ROS [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    19886 (Ros1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     19886 (Ros1)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  ROS family
   19886 (Ros1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr fn3 Pkinase fn3_4
Motif
Other DBs
NCBI-GeneID: 19886
NCBI-ProteinID: NP_035412
MGI: 97999
Ensembl: ENSMUSG00000019893
UniProt: Q78DX7
Position
10 B3; 10 26.18 cM
AA seq 2340 aa AA seqDB search
MKNICWLTLKLVKFVVLGCIIWISVAQSTVLSSCLTSCVTNLGRQLDSGTRYNLSEACIH
GCQFWNSVDQETCALKCNDTYATICERESCEVGCSNAEGSYEEEVLESTELPTAPFASSI
GSHGVTLRWNPANISGVKYIIQWKYAQLPGSWTFTETVSKLSYTVEPLHPFTEYIFRVVW
IFTAQLHLYSPPSPSYRTHPYGVPETAPLILNMESWSPDTVEVSWAPPHFPGGPILGYNL
RLISKNQKLDSGTQRTSFQFYSTLPNTTYRFSIAAVNEVGEGPEAESTVTTPSPSVQEEE
QWLFLSRKTSLRKRSLKYLVDEAHCLWSDAIHHNITGISVYAQQQVVYFSEGTVIWMKGA
ANMSDVSDLRIFYQGSGLVSSISIDWLYQRMYFIMDKLVYVCELKNCSNLEEITPFSLIA
PQKVVVDSYNGYLFYLLRDGIYRVNLPLPSGRDTKAVRIVESGTLKDFAVKPQSKRIIYF
NDTMQLFMSTFLDGSAFHRVLPWVPLVTVKSFACENNDFLITDGKAIFQQDSLSFNEFIV
GCDLSHIEEFGFGNLVIFGSSVQSYPLPGHPQEVSVLFGSREALIQWTPPALAIGASPSA
WQNWTYEVKVYSQDILEITQVFSNISGTMLNVPELQSSTKYTVSVRASSPKGPGPWSAPS
VGTTLVPATEPPFIMAVKEDGLWSKPLCSFGPGEFLSSDVGNVSDMDWYNNSLYYSDTKG
NVYVRPLNGMDISENYHIPSIVGAGALAFEWLGHFLYWAGKTYVIQRQSVLTGHTDIVTH
VKLLVNDMAVDSVGGYLYWTTLYSVESTRLNGESSLVLQAQPWLSGKKVIALTLDLSDGL
LYWLVQDNQCIHLYTAVLRGWSGGDATITEFAAWSTSEISQNALMYYSGRLFWINGFRII
TAQEIGQRTSVSVSEPAKFNQFTIIQTSLKPLPGNFSSTPKVIPDPVQESSFRIEGHTSS
FQILWNEPPAVDWGIVFYSVEFSTHSKFLIIEQQSLPIFTVEGLEPYTLFNLSVTPYTYW
GKGQKTSLSFRAPESVPSAPENPRIFILSSGRYTKKNEVVVEFRWNKPKHENGVLTKFEI
FYHISKQSGTNRSTEDWMSASVIPPVMSFQLEAVSPEYTVAFQVRVFTSKGPGPFSDIVM
SKTSEIKPCPYLISLLGNKIVFLDMDQNQVLWTFSLEGDVSTVGYTTDDEMGYFAQGDTL
FLLNLRNHSSSKLFQDALVSDIRVIAVDWIARHLYFALKASQNGTQIFNVDLEHKVKSPR
EVKTCKAHTTIISFSIYPLLSRLYWTEVSDLGHQMFYCNISNHTSQHVLQPKASNQHGRS
QCSCNVTESELSGAMTVDTSDPDRPWIYFTKRQEIWAMDLEGCQCWKVIMVPTIPGKRII
SLTVDGEFIYWIMKTKDDAQIYQAKKGSGAILSQVKASRSKHILAYSSALQPFPDKAYLS
LASDMVEATILYATNTSLTLKLPPVKTNLTWHGITHPTSTYLIYYMEANRANSSDRRHKM
LESQENVARIEGLQPFSMYMIQIAVKNYYSEPLEHLPLGKEIQGQTKSGVPGAVCHINAT
VLSDTSLHVFWTESHKPNGPKESVRYQLVMSYLAPIPETPLRQGEFPSAKLSLLITKLSG
GQLYVMKVLACHPEEMWCTESHPVSVNMFDTPEKPSALVPENTSLQLDWKARSNVNLTGF
WFELQKWKYNEFYHVKASCSQGPVYVCNITDLQPYTSYNIRVVVVYTTGENSSSIPESFK
TKAGVPSKPGIPKLLEGSKNSIQWEKAEDNGSRLMYYTLEVRKGISNDSQNQSSRWKVVF
NGSCSSICTWRSKNLKGTFQFRAVAANEIGLGEYSEISEDITLVEDGVWITETSFILTII
VGIFLVATVPLTFVWHRSLKSHKASKEGLSVLNDNDKELAELRGLAAGVGLANACYAVHT
VPTQEEIENLPAFPREKLSLRLLLGSGAFGEVYEGTAIDILGVGSGEIKVAVKTLKKGST
DQEKIEFLKEAHLMSKFNHPNILKQLGVCLLGEPQYIILELMEGGDLLSYLRKARGTTFH
GPSLTLLDLVELCVDISKGCVYLEQMHFIHRDLAARNCLVSVKDYTSPRVVKIGDFGLAR
EIYKNDYYRKRGEGLLPVRWMAPENLMDGIFTSQSDVWSFGILVWEILTLGHQPYPAHSN
LDVLNYVQAGGRLEPPRNCPDDLWNLMSQCWAQEPDQRPTFHNIQNQLQLFRNVFLNNVS
HCGEAAPTGGVINKGFEGEDDEMVTLNSDDTMPVALMETKNQEGLNYMVLATKCSQGEGS
YEGPLGPKELGSCDLKKDKKQPQADKDFCQEPQVAYGSPGLSEGLNYACLAHSEHGDVSE
NT seq 7023 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacatctgctggctcaccctgaaacttgtgaagtttgtggtccttgggtgcatc
atatggatttctgtggcacagagtacagttctgagcagctgcctaacgtcctgtgtaact
aacctgggcaggcagcttgacagtggcacacggtacaatctgagtgaggcgtgcatccat
ggatgtcagttttggaactctgtagatcaggaaacgtgtgctttaaagtgtaatgacacc
tacgccaccatttgtgagagggagtcctgtgaggtcggctgcagcaatgcggagggtagc
tacgaagaggaagtgctggaaagcacagaacttcctacagcaccctttgcatcttccatt
ggaagtcatggtgtgacattacgctggaaccctgccaacatctctggagtcaaatacata
attcaatggaaatatgcccaacttccaggaagctggactttcacggagaccgtgtccaag
ctctcatacacggtggaacccctgcatccattcacagaatatatttttcgagtggtttgg
atcttcacagcccaactgcatctttattccccaccaagtcccagttacaggactcatcct
tatggagttccagaaactgcacctctcatcctgaacatggaaagctggagccctgatact
gtggaggtcagctgggctccacctcatttcccaggtggacctattttgggttataattta
aggctcatcagtaaaaatcaaaaattagattcagggacacagagaaccagtttccagttt
tattctactctaccaaacaccacctacaggttttctatcgcagcagtcaatgaagttggt
gaggggccagaagcagaatctacagttaccactccatccccatcagttcaagaagaagaa
caatggctctttttatccagaaaaacttctctaagaaagaggtctttgaagtacttagta
gatgaagcacattgcctttggtcagatgctatacaccataatattacaggaatatcagtc
tatgctcagcagcaagtggtttatttttcagaaggaactgtcatctggatgaagggggct
gccaacatgtctgatgtgtctgacctgagaattttttaccaaggctcaggtctagtgtct
tctatctccatagactggctgtaccaaaggatgtatttcatcatggataaactggtatat
gtctgtgaattaaagaattgctcaaatttagaggaaatcactcccttctctcttattgca
cctcagaaagttgtggttgactcctacaatgggtacctcttttatctcctgagagacggc
atctacagagtcaatctccctttgccatctggcagggacaccaaagctgtgcgtattgtg
gagagtggcacattaaaggactttgcagtaaagccccaatccaagcgaatcatttacttc
aatgacaccatgcaactcttcatgtcaacgtttctggatggctctgccttccaccgggtc
ctgccttgggtcccccttgtgactgtgaagagctttgcttgtgaaaacaatgacttcctc
atcacagatggcaaggccatttttcagcaggactccctgtctttcaatgaattcatcgtg
ggatgtgacctgagtcacatagaagagtttgggtttggtaacttggtcatctttggctcc
tctgtccagtcataccctctgccaggacatccacaggaggtctcagtgctgtttggttct
cgagaggcccttattcagtggacgcctcctgctctcgccataggagccagtccttccgcc
tggcagaactggacttatgaagtcaaagtttattcccaggacatccttgaaatcactcaa
gttttctcgaacataagcgggaccatgcttaatgtacccgaactgcagagttctacaaag
tacactgtctctgtgagagcaagttctcctaaaggcccaggcccctggtcagcaccatca
gtgggtaccaccttggtaccagctactgaaccaccattcatcatggctgtgaaagaagat
gggctctggagcaaaccactctgtagttttggtccaggagaattcctgtcctctgatgta
ggaaacgtgtcagatatggattggtacaacaacagcctctactacagtgacacaaaaggc
aacgtttatgtgcggcctctgaatgggatggatatctcagagaattatcacatacccagc
attgtaggagctggggctttggcctttgaatggctgggtcactttctctactgggctggg
aagacatatgtgatccaaaggcagtctgtgttgacgggacacacggacattgtgactcat
gtgaagctgttggtgaatgacatggctgtggattcagttggtggctatctctattggaca
acactctactcagttgaaagcaccagactcaatggagaaagttctcttgtactacaggct
cagccctggctctctggaaaaaaggttattgctctaacactagacctcagtgatgggctc
ctgtattggctggtgcaggacaatcagtgtattcatctgtacacagctgttcttcgagga
tggagtggtggggatgctaccatcacagagtttgcagcctggagtacttctgaaatctcc
cagaatgcactgatgtactacagtggtagactcttctggatcaatggatttaggatcatt
acagcacaggaaataggtcagagaaccagtgtgtctgtttcggagccagcgaaattcaat
cagttcacaattatacagacatctctcaagcctctgccaggaaacttttcctctactccc
aaggttatcccagatcctgttcaggagtcttcatttcgaattgaaggacacacttcaagt
ttccaaatcctgtggaatgagccccctgcggtggactggggcatcgttttctacagtgtg
gaatttagcactcattccaagttcctgattattgaacaacagtctttacctatttttact
gtggaaggactggagccctataccttatttaatctttctgtcactccttatacctactgg
ggaaagggccaaaaaacatctctatcatttcgtgcacctgaatcagttccatcagcacca
gaaaaccccagaatatttatattgtcaagcggaagatacaccaagaagaatgaagttgtg
gtagagttcaggtggaataaacctaagcatgaaaatggagtgctaaccaaatttgaaatc
ttctatcacatatctaaacaaagtggcacaaatagatcaactgaagactggatgtctgcc
agtgttatacccccagtgatgtcttttcaacttgaggctgtgagtcctgagtatactgtt
gccttccaggttagagtcttcacatccaaagggccagggccattttctgatatagtgatg
tctaaaacatcagaaatcaagccatgtccgtatctcatatctcttctcggcaataagatc
gtgtttctagacatggatcaaaatcaagttttgtggacattttccctggagggagacgtc
agcacagtggggtacacaacagacgatgaaatggggtatttcgctcaaggagacacgctc
ttccttctgaatttgcgtaatcattccagttccaagcttttccaggatgcactggtttct
gacattagagttattgctgttgattggattgcaaggcacctctactttgctctgaaagca
tcacaaaacggaacacagatattcaatgttgaccttgaacacaaggtgaaatcccccagg
gaggtgaagacttgcaaagcacatacaacaataatttctttctctatatatcccctcttg
agtcgcttgtattggacagaagtttcagatctgggccatcagatgttctactgcaatatt
agcaatcacacctcgcaacatgttctacaacccaaggcttcaaaccaacatggaaggagt
caatgttcttgtaatgtgacagaatctgagttaagtggggcaatgactgtggatacctct
gacccagacagaccatggatatactttaccaaaaggcaagagatctgggccatggatctg
gaaggatgtcagtgttggaaagtcatcatggtacctactatccctggaaaaagaatcatt
agcttaacagtggatggggagtttatatattggatcatgaaaacaaaggatgatgcccaa
atttatcaagcaaagaagggaagcggggccatcctttcccaagtgaaggcctccaggagt
aagcatatcttggcttacagttctgctctgcagccttttccagataaagcatatctgtct
ctagcttcagatatggtagaagcaactatattatatgccaccaacaccagcctcacactc
aaattacctccagtcaagacaaacctcacgtggcatggtattacccaccccacgtcaaca
tacctgatttactatatggaagctaatagggcaaacagctctgacaggagacacaaaatg
ctggaatcacaggagaatgtagcccggattgaaggtctgcagccattttcaatgtacatg
attcagatagctgtgaagaactattattcagagcctttagaacatttacctcttggaaaa
gagattcaaggacaaactaaaagtggagtgcctggggcagtttgtcatatcaacgcaact
gtgttgtcggacaccagtctccatgtattctggacagaatcccataagccaaacggacca
aaagagtcagtccgctatcagctggttatgtcatacctggctcccattcctgagactcct
ctaagacagggtgaatttccaagtgccaagctttctctgctcatcactaaactatctggt
ggacagctctatgtgatgaaggttctggcgtgccaccctgaggaaatgtggtgtactgag
agtcatcctgtcagtgtcaacatgtttgacacaccagagaaaccctctgccttggttcca
gagaacactagtctgcagttagattggaaggctcgatcaaacgttaacctcaccggattt
tggtttgaactccagaagtggaaatataatgagttttaccatgtcaaagcttcatgcagc
caaggtccagtttatgtctgtaacatcacagatctacaaccttacacctcctataacatt
cgagtggtggtggtctatacgacaggagaaaatagctcctccattccagagagtttcaag
acaaaagccggagtcccaagcaaaccaggtattcctaaattactagaagggagtaaaaat
tccatccagtgggaaaaagctgaagataatgggagcagattgatgtactacacccttgag
gtcagaaaaggcatttcaaatgactcacagaaccagagttcaaggtggaaggtggtgttt
aatgggtcctgcagtagcatttgcacatggagatcaaaaaacctaaaaggaacatttcag
ttcagagcagttgctgcaaatgaaattggacttggagaatatagtgaaatcagtgaagac
attacattagtggaagatggtgtttggataacagaaacaagttttatacttactatcata
gttgggatatttctggttgctacagtcccactgacctttgtctggcatagaagcttgaaa
agtcacaaagcttccaaggaaggcctctcggttctcaacgacaacgacaaagagttggct
gagcttcgaggtctggcggctggagtgggactggccaatgcctgctacgcagtacatact
gttccaacccaagaagagattgaaaatcttcctgccttccctcgggagaagctgagcctg
cgtcttttgttgggaagtggagcttttggagaagtgtatgaaggcacagctatagacatc
ctaggcgtgggaagtggagaaatcaaagtggcagtgaagaccttgaagaaaggttcaaca
gaccaggagaagattgagttcctgaaggaggcgcacctgatgagcaagtttaatcacccc
aacattctgaagcagctgggagtctgtctgttaggcgaaccccagtacattattctggaa
ctgatggaagggggagaccttctaagctatctgcgcaaagctcgggggacaacgtttcat
ggtccttcactcaccttgcttgaccttgtagagctgtgtgtagatatttcaaaaggctgc
gtctacttggagcagatgcacttcattcacagggatctggcagctcggaattgccttgta
tcagtgaaagactacaccagtcctcgggtagtcaagattggtgactttggattggcaaga
gaaatctataaaaatgattattatagaaagagaggggaaggcctgcttcctgttcggtgg
atggctcctgaaaacttgatggacggaatcttcacttctcagtctgatgtatggtccttt
ggaattttggtgtgggagattttaactctcggtcatcaaccttatccagcgcattccaac
cttgatgttttaaactatgtgcaagcaggagggagactggagccaccaagaaattgtcct
gatgatctgtggaatttaatgtcccaatgctgggctcaagaacctgaccaaagacccact
ttccataacattcaaaaccagcttcagttattcagaaatgttttcttaaacaatgtttct
cattgtggagaagcagctcccaccggtggagtcatcaacaaaggctttgaaggtgaagat
gatgaaatggtcactttgaactcagatgacacgatgccagttgccttgatggaaaccaag
aaccaagaaggattaaattatatggtgcttgccacaaaatgtagccaaggtgaaggaagt
tatgagggtcctctaggccctaaggaacttgggtcatgtgatctgaagaaagacaagaag
caaccacaggcagacaaagatttctgccaggaaccacaggtggcttatggctctcctggc
ctgtctgaaggcctgaattatgcctgtcttgctcacagtgaacatggagatgtgtctgaa
taa

DBGET integrated database retrieval system