KEGG   Mus musculus (mouse): 19891
Entry
19891             CDS       T01002                                 

Gene name
Rpa2, AA409079, AI325195, AU020965, RP, RPA34, Rf-, Rf-A2
Definition
(RefSeq) replication protein A2
  KO
K10739  replication factor A2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu03420  Nucleotide excision repair
mmu03430  Mismatch repair
mmu03440  Homologous recombination
mmu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    19891 (Rpa2)
   03420 Nucleotide excision repair
    19891 (Rpa2)
   03430 Mismatch repair
    19891 (Rpa2)
   03440 Homologous recombination
    19891 (Rpa2)
   03460 Fanconi anemia pathway
    19891 (Rpa2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    19891 (Rpa2)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    19891 (Rpa2)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    19891 (Rpa2)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     19891 (Rpa2)
   MMR (mismatch excision repair)
     19891 (Rpa2)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     19891 (Rpa2)
SSDB
Motif
Pfam: RPA_C tRNA_anti-codon MarR_2
Other DBs
NCBI-GeneID: 19891
NCBI-ProteinID: NP_035414
MGI: 1339939
Ensembl: ENSMUSG00000028884
Vega: OTTMUSG00000009961
UniProt: Q3TE40
Position
4; 4 D2.3
AA seq 270 aa
MWNSGFESFSSSTYGGAGGYTQSPGGFGSPTPSQAEKKSRVRAQHIVPCTISQLLSATLT
DEVFRIGDVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAPPMDVRQWVDTDDASGENAVV
PPETYVKVAGHLRSFQNKKSLVAFKIIPLEDMNEFTAHILEVVNSHMMLSKPNSQASAGR
PSMSNPGMSEPGNFSGNNFMPANGLTVVQNQVLNLIKACPRPEGLNFQDLRSQLQHMPVP
SIKQAVDFLCNEGHIYSTVDDDHFKSTDAE
NT seq 813 nt   +upstreamnt  +downstreamnt
atgtggaatagcggattcgaaagcttcagcagctccacctatggcggagcaggcggctac
acgcagtcccccggtggcttcgggtcgcccacaccgtcgcaggcggagaagaaatcgaga
gtccgagcccagcatattgtgccctgtaccatatcccagctgctttctgctactctgact
gatgaagtgttcagaattggagatgtcgagatttcacaggtcactattgtggggataatc
agacatgcggagaaggctccaaccaacattgtttacaagatagacgatatgacagctccg
cccatggatgttcgtcagtgggttgacacggatgatgccagtggtgagaacgccgtggtt
cctcccgaaacatacgtgaaagtcgctggtcacctcaggtctttccagaacaaaaagagc
ttggtggcctttaagatcattcctctggaagacatgaatgagttcaccgcacacatcctg
gaagtggtcaattcacacatgatgctcagcaagcccaacagccaggcctctgcagggaga
ccatcgatgagcaacccaggaatgagtgagccggggaacttcagcgggaataacttcatg
ccagcaaatggcctcactgtggtccaaaaccaggtgctgaatttgatcaaggcttgccca
agacctgaaggcctgaacttccaggacctcaggagccagctccagcatatgcctgttccc
tcaatcaagcaagcagtggattttctgtgcaacgagggccacatttactctactgtggac
gacgatcactttaagtctacagatgcagagtga

DBGET integrated database retrieval system