KEGG   Mus musculus (mouse): 19891
Entry
19891             CDS       T01002                                 

Gene name
Rpa2, AA409079, AI325195, AU020965, RP, RPA34, Rf-, Rf-A2
Definition
(RefSeq) replication protein A2
  KO
K10739  replication factor A2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu03420  Nucleotide excision repair
mmu03430  Mismatch repair
mmu03440  Homologous recombination
mmu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    19891 (Rpa2)
   03420 Nucleotide excision repair
    19891 (Rpa2)
   03430 Mismatch repair
    19891 (Rpa2)
   03440 Homologous recombination
    19891 (Rpa2)
   03460 Fanconi anemia pathway
    19891 (Rpa2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    19891 (Rpa2)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    19891 (Rpa2)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    19891 (Rpa2)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     19891 (Rpa2)
   MMR (mismatch excision repair)
     19891 (Rpa2)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     19891 (Rpa2)
SSDB
Motif
Pfam: RPA_C tRNA_anti-codon
Other DBs
NCBI-GeneID: 19891
NCBI-ProteinID: NP_035414
MGI: 1339939
Ensembl: ENSMUSG00000028884
Vega: OTTMUSG00000009961
UniProt: Q3TE40
Position
4; 4 D2.3
AA seq 270 aa
MWNSGFESFSSSTYGGAGGYTQSPGGFGSPTPSQAEKKSRVRAQHIVPCTISQLLSATLT
DEVFRIGDVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAPPMDVRQWVDTDDASGENAVV
PPETYVKVAGHLRSFQNKKSLVAFKIIPLEDMNEFTAHILEVVNSHMMLSKPNSQASAGR
PSMSNPGMSEPGNFSGNNFMPANGLTVVQNQVLNLIKACPRPEGLNFQDLRSQLQHMPVP
SIKQAVDFLCNEGHIYSTVDDDHFKSTDAE
NT seq 813 nt   +upstreamnt  +downstreamnt
atgtggaatagcggattcgaaagcttcagcagctccacctatggcggagcaggcggctac
acgcagtcccccggtggcttcgggtcgcccacaccgtcgcaggcggagaagaaatcgaga
gtccgagcccagcatattgtgccctgtaccatatcccagctgctttctgctactctgact
gatgaagtgttcagaattggagatgtcgagatttcacaggtcactattgtggggataatc
agacatgcggagaaggctccaaccaacattgtttacaagatagacgatatgacagctccg
cccatggatgttcgtcagtgggttgacacggatgatgccagtggtgagaacgccgtggtt
cctcccgaaacatacgtgaaagtcgctggtcacctcaggtctttccagaacaaaaagagc
ttggtggcctttaagatcattcctctggaagacatgaatgagttcaccgcacacatcctg
gaagtggtcaattcacacatgatgctcagcaagcccaacagccaggcctctgcagggaga
ccatcgatgagcaacccaggaatgagtgagccggggaacttcagcgggaataacttcatg
ccagcaaatggcctcactgtggtccaaaaccaggtgctgaatttgatcaaggcttgccca
agacctgaaggcctgaacttccaggacctcaggagccagctccagcatatgcctgttccc
tcaatcaagcaagcagtggattttctgtgcaacgagggccacatttactctactgtggac
gacgatcactttaagtctacagatgcagagtga

KEGG   Mus musculus (mouse): 68240
Entry
68240             CDS       T01002                                 

Gene name
Rpa3, 14kD, 14kDa, C330026P08Rik
Definition
(RefSeq) replication protein A3
  KO
K10740  replication factor A3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu03420  Nucleotide excision repair
mmu03430  Mismatch repair
mmu03440  Homologous recombination
mmu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    68240 (Rpa3)
   03420 Nucleotide excision repair
    68240 (Rpa3)
   03430 Mismatch repair
    68240 (Rpa3)
   03440 Homologous recombination
    68240 (Rpa3)
   03460 Fanconi anemia pathway
    68240 (Rpa3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    68240 (Rpa3)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    68240 (Rpa3)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    68240 (Rpa3)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     68240 (Rpa3)
   MMR (mismatch excision repair)
     68240 (Rpa3)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     68240 (Rpa3)
SSDB
Motif
Pfam: Rep_fac-A_3
Other DBs
NCBI-GeneID: 68240
NCBI-ProteinID: NP_080908
MGI: 1915490
Ensembl: ENSMUSG00000012483
Vega: OTTMUSG00000029297
UniProt: Q9CQ71
Position
6; 6 A1
AA seq 121 aa
MEDIMQLPKARVNASMLPQYIDRPVCFVGKLEKIHPTGKMFILSDGEGKNGTIELMEPLD
EEISGIVEVVGKVTAKATVLCASYTLFKEDTNRFDLELYNEAVKIINELPQFFPVGLPQH
E
NT seq 366 nt   +upstreamnt  +downstreamnt
atggaggacataatgcagctccccaaagcgcgcgtcaacgccagcatgttaccacagtat
atcgaccggcccgtgtgcttcgtggggaagctggaaaagattcatcccactggaaaaatg
tttattctttcagatggagaaggaaaaaatggaaccattgaattgatggagccacttgac
gaggaaatctctgggattgtagaagtagttggaaaagtcacagccaaggcgaccgtgctc
tgtgcatcttataccctgtttaaggaagatactaatcgctttgatcttgaactttacaat
gaagctgtgaaaattatcaatgagcttcctcagtttttccctgtagggcttccacaacat
gaatga

KEGG   Mus musculus (mouse): 68275
Entry
68275             CDS       T01002                                 

Gene name
Rpa1, 5031405K23Rik, 70kD, 70kDa, AA589576, AW557552, R, RF, RF-A, RP-A, Rpa
Definition
(RefSeq) replication protein A1
  KO
K07466  replication factor A1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu03420  Nucleotide excision repair
mmu03430  Mismatch repair
mmu03440  Homologous recombination
mmu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    68275 (Rpa1)
   03420 Nucleotide excision repair
    68275 (Rpa1)
   03430 Mismatch repair
    68275 (Rpa1)
   03440 Homologous recombination
    68275 (Rpa1)
   03460 Fanconi anemia pathway
    68275 (Rpa1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    68275 (Rpa1)
   03032 DNA replication proteins [BR:mmu03032]
    68275 (Rpa1)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    68275 (Rpa1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    68275 (Rpa1)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    68275 (Rpa1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     68275 (Rpa1)
   MMR (mismatch excision repair)
     68275 (Rpa1)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     68275 (Rpa1)
SSDB
Motif
Pfam: Rep_fac-A_C REPA_OB_2 Rep-A_N tRNA_anti-codon SUIM_assoc IBR Spt20
Other DBs
NCBI-GeneID: 68275
NCBI-ProteinID: NP_080929
MGI: 1915525
Ensembl: ENSMUSG00000000751
Vega: OTTMUSG00000006199
UniProt: Q8VEE4
Position
11 B5; 11 45.79 cM
AA seq 623 aa
MVGHLSEGAIEVMIQQENTSIKPILQVINIRPISTGNRSPRYRLLMSDGLNTLSSFMLAT
QLNTLVEGGQLASNCVCQVHKFIVNTLKDGRKVVVLMDLEVMKSAEDVGLKIGNPVPYNE
GYGQQQQQQQQQQQQAVPSPASAATPPASKPQPQNGSLGMGSTAAKAYGASKPFGKPAGT
GLLQPSGGTQSKVVPIASLTPYQSKWTICARVTNKSQIRTWSNSRGEGKLFSLELVDESG
EIRATAFNEQVDKFFPLIEVNKVYYFSKGALKIANKQFSAVKNDYEMTFNNETSVLPCED
GHHLPTVQFDFTGIGDLESKAKDALVDIIGICKSYEDSIKITVKSNNREVAKRNIYLMDM
SGKVVTTTLWGEDADKFDGSRQPVMAIKGARVSDFGGRSLSVLSSSTVIVNPDIPEAYKL
RGWFDSEGQALDGVSISDHRSGGAGGGNTNWKTLHEAKSENLGQGDKADYFSTVAAVVFL
RKENCMYQACPTQDCNKKVIDQQNGLYRCEKCDREFPNFKYRMILSANIADFQENQWVTC
FQESAEAILGQNTMYLGELKEKNEQAFEEVFQNANFRSFTFRIRVKLETYNDESRIKATV
MDVKPVDFRDYGRRLIANIRKNM
NT seq 1872 nt   +upstreamnt  +downstreamnt
atggtgggacacctgagcgagggggccatcgaggtcatgatacagcaggaaaatacatcc
ataaagcccatcctgcaggtcattaacatccgtcccatttctacagggaataggtcaccc
cggtaccgactgctcatgagtgatgggttgaacacgctttcctcgttcatgctggccacg
cagctgaacaccctggtcgagggagggcagctggccagcaactgtgtctgccaggtccac
aagttcatcgtcaacaccctgaaagacggcaggaaagtagttgttttgatggacttggaa
gttatgaaatctgctgaagacgttggattaaagattgggaatccagtgccctataatgaa
ggatatgggcagcagcagcagcagcagcagcagcagcagcagcaagcagtcccttcccca
gcctctgcagcgacaccaccagccagcaagccccagccacagaatgggagtctgggaatg
ggttccactgcagctaaggcttatggtgcctcaaagccatttggaaaacctgccggaact
ggcctgctgcagccttcaggtgggacacagtccaaagtggtgcccatcgccagcctcacc
ccgtaccagtccaagtggactatttgtgcccgtgtcaccaacaaaagtcagatccgcacc
tggagtaattcccggggggaaggaaagcttttctctctagaacttgtggatgaaagcggt
gaaatcagagctactgctttcaatgagcaagtggacaagttctttccccttattgaagtg
aacaaggtgtattacttctcaaagggcgccctgaagatcgctaacaaacagttctccgct
gttaaaaatgactatgagatgaccttcaataatgagacttctgtccttccctgtgaagat
ggccatcacttacccacagttcagtttgatttcacagggatcggtgacctagagagcaag
gctaaagacgcactagtagacatcattggaatctgcaagagctatgaagattcgattaaa
atcacagtgaagtcgaacaacagagaagttgctaagagaaatatctatttgatggacatg
tcagggaaggtggtgaccacaactctgtggggagaagatgctgacaagtttgacggctct
cggcagcccgtgatggccatcaaaggagcccgagtctctgacttcggtggacggagcctc
tcggtcctctcatccagcactgtcattgtgaatcctgacatcccagaggcctataagctt
cgtggctggtttgactcagaaggacaagccttagatggtgtttccatctctgaccacagg
agtggaggggccggagggggcaacaccaactggaaaactttgcatgaggctaaatctgag
aacctgggccagggagacaaggcggactatttcagcactgtggcagcggtggtgtttctc
cgcaaagagaactgtatgtaccaggcctgcccaacccaggactgcaataagaaagtgatt
gaccagcagaatgggttgtaccgctgtgagaagtgtgaccgggaatttcccaatttcaaa
taccgcatgatcttatcggcaaatattgcagattttcaagagaaccagtgggtgacgtgt
ttccaggagtctgcagaggccatccttggacagaacactatgtaccttggggaactcaaa
gagaagaacgagcaggcgtttgaagaggttttccagaatgccaacttccggtcatttacg
ttcagaatcagggtcaagctggagacctacaatgatgaatctcgaattaaggccactgtg
atggacgtgaagcccgtggacttcagagactatggcagacggctgatcgcgaacatcagg
aagaacatgtga

DBGET integrated database retrieval system