KEGG   Mus musculus (mouse): 19899
Entry
19899             CDS       T01002                                 

Gene name
Rpl18, L1, L18, Rp, Rpl18a
Definition
(RefSeq) ribosomal protein L18
  KO
K02883  large subunit ribosomal protein L18e
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03010  Ribosome
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    19899 (Rpl18)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    19899 (Rpl18)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mmu03011]
    19899 (Rpl18)
Ribosome [BR:mmu03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    19899 (Rpl18)
  Archaea
    19899 (Rpl18)
SSDB
Motif
Pfam: Ribosomal_L18 Ribosomal_L27A
Other DBs
NCBI-GeneID: 19899
NCBI-ProteinID: NP_033103
MGI: 98003
Ensembl: ENSMUSG00000059070
Vega: OTTMUSG00000023185
UniProt: P35980 Q58EW0 Q642K1
Position
7; 7 B3
AA seq 188 aa
MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRLFMSRTNRPP
LSLSRMIRKMKLPGRENKTAVVVGTVTDDVRILEVPKLKVCALRVSSRARSRILKAGGKI
LTFDQLALESPKGRGTVLLSGPRKGREVYRHFGKAPGTPHSHTKPYVRSKGRKFERARGR
RASRGYKN
NT seq 567 nt   +upstreamnt  +downstreamnt
atgggtgttgacattcgccacaacaaggaccgaaaggttcggcgcaaggagcccaagagc
caggacatctacctgcggctgcttgtcaagctgtacaggtttctggccagacggaccaac
tccaccttcaatcaggttgtgctgaagaggttgttcatgagccgaaccaaccggccacct
ctgtccctgtcccgcatgatccgaaagatgaagcttcctggccgcgagaacaagactgcc
gtggttgtggggacggtcacagatgatgtgcggattctggaagttcccaagctgaaggtg
tgtgcactgcgggtgagcagccgggcccggagtcgcatcctcaaggctgggggtaagatc
ctcacctttgaccagctggccctggagtctcccaagggccggggcactgtgctcctgtct
ggtcctcggaagggccgagaggtgtaccgacattttggcaaggccccaggaaccccacac
agccataccaaaccctatgtccgttccaagggccggaagtttgagcgcgccagaggccga
agggccagcagaggctacaaaaactaa

DBGET integrated database retrieval system