KEGG   Mus musculus (mouse): 20014
Entry
20014             CDS       T01002                                 

Gene name
Rpn2, 1300012C06Rik, AV261018, Rp, Rpn-2
Definition
(RefSeq) ribophorin II
  KO
K12667  oligosaccharyltransferase complex subunit delta (ribophorin II)
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00510  N-Glycan biosynthesis
mmu00513  Various types of N-glycan biosynthesis
mmu01100  Metabolic pathways
mmu04141  Protein processing in endoplasmic reticulum
Module
mmu_M00072  N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    20014 (Rpn2)
   00513 Various types of N-glycan biosynthesis
    20014 (Rpn2)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    20014 (Rpn2)
SSDB
Motif
Pfam: Ribophorin_II HSM3_N DUF5859
Other DBs
NCBI-GeneID: 20014
NCBI-ProteinID: NP_062616
MGI: 98085
Ensembl: ENSMUSG00000027642
Vega: OTTMUSG00000016167
UniProt: Q9DBG6
Position
2 H1; 2 78.2 cM
AA seq 631 aa
MAPPGSSAVFLLALTITASVQALTPTHYLTKQDVERLKASLDRPFTDLESAFYSIVGLSS
LGVQVPDVKKACTFIKSNLDPSNVDSLFYAAQSSQVLSGCEISVSNETKELLLAAVSEDS
PIAQIYHAVAALSGFGLPLASNEALGALTARLGKEETVLATVQALQTASHLSQQADLRNI
VEEIEDLVARLDELGGVYLQFEEGLELTALFVAATYKLMDHVGTEPSMKEDQVIQLMNTI
FSKKNFESLSEAFSVASAAAALSQNRYHVPVVVVPEGSTSDTQEQAILRLQVSNVLSQPL
AQAAVKLEHAKSAATRATVLQKTPFSLVGNVFELNFKNVKLSSGYYDFSVRVEGDSRYIA
NTVELRVKISTEVGITNVDLSTVDKDQSIAPKTTRVTYPAKAKGTFIADSHQNFALFFQL
VDVNTGAELTPHQTFVRLHNQKTGQEVVFVAEPDNKNVYKFELDTSERKIEFDSASGTYT
LYLIIGDATLKNPILWNVADVVIKFPEEEAPSTVLSQSLFTPKQEIQHLFREPEKRPPTV
VSNTFTALILSPLLLLFALWIRIGANVSNFTFAPSTVIFHLGHAAMLGLMYIYWTQLNMF
QTLKYLAVLGTVTFLAGNRMLAQHAVKRTAH
NT seq 1896 nt   +upstreamnt  +downstreamnt
atggcgccgccgggttcaagcgctgtcttcctgttggccctgacaatcactgccagcgtc
caggctctgacccccacccactacctcaccaagcaggatgtggaaaggctgaaggcctca
ctggaccgccccttcacagatttggagtctgccttctactccatcgtgggactcagcagc
cttggggtacaggtgccagatgtcaagaaagcgtgtaccttcatcaagtccaaccttgat
cccagcaacgtggattctctcttctatgcagcccagtccagccaggtcctctcaggctgt
gagatatctgtttcaaatgagaccaaagagctcctgctggcagcagtgagtgaagactcc
cccattgcccagatctaccatgcagttgcagcactcagcgggtttgggcttcccttggca
tccaatgaagccctcggtgcccttaccgctcgcctcggcaaggaagagactgtgctagca
acggtccaggctctgcagacagcgtcccacctctcccagcaggctgacctgaggaacatt
gtagaggagattgaggaccttgttgctcggctggatgaactagggggtgtgtatctgcag
tttgaggaaggactggagctcacggcgctgtttgttgctgccacctacaagctcatggac
cacgtggggaccgaaccgtccatgaaggaggatcaggttatccagctcatgaacacaatc
ttcagcaagaagaactttgagtccctctcagaagccttcagtgtggcctctgctgctgct
gcattgtcccagaatcgctaccacgtaccagtggtggttgtgcccgagggctctacttct
gacactcaagaacaggctatcctgaggttgcaggtcagcaatgttttgtctcagcctctg
gctcaagctgcagtgaagctggagcatgctaagtcggcggctaccagggctaccgtcctg
cagaagacgcccttttcgcttgtggggaatgtttttgagctaaacttcaagaatgttaaa
ctttccagtggctactatgacttctctgtccgagttgaaggtgacagccgttacattgca
aacactgtagagcttcgagtcaagatctccactgaagttggcatcacaaatgttgatctt
tccactgtggataaggatcagagcattgcacccaaaactacccgggtgacctacccagcc
aaagccaagggtacattcatcgcagacagccatcagaactttgccctgtttttccagctg
gtagatgtgaacaccggtgcggagctcacccctcaccagacgtttgttcgacttcataac
cagaagactggccaggaagtggtgtttgttgctgagccagataacaagaatgtatataag
tttgaactggacacctctgaaaggaagattgaatttgactctgcctctggcacctacaca
ctctacttaatcatcggggatgccacattgaagaacccaatcctctggaacgtggctgac
gtggttatcaagttccctgaggaggaagccccctcgactgtgctgtcccagagcctgttt
accccaaaacaggaaattcagcacctgttccgagagcctgagaagaggccccccacagtg
gtgtccaatacattcacggccctcatcctctcgcccttgctcctgctctttgcactgtgg
atccggattggagccaatgtctccaacttcacatttgctcctagcacagttatcttccac
ctgggacatgctgcgatgctgggcctcatgtatatctactggactcagctcaacatgttc
cagaccctcaagtacctggctgtcctgggcactgtgacgtttctggctggcaaccgaatg
ctggcccagcatgcagttaagagaacagcacattag

DBGET integrated database retrieval system