KEGG   Mus musculus (mouse): 20016
Entry
20016             CDS       T01002                                 

Gene name
Polr1c, 40kD, 40kDa, AA409007, AA959927, AL024089, Polr1e, RP, RPA40, Rpo, Rpo1-1
Definition
(RefSeq) polymerase (RNA) I polypeptide C
  KO
K03027  DNA-directed RNA polymerases I and III subunit RPAC1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
mmu04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    20016 (Polr1c)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    20016 (Polr1c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    20016 (Polr1c)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Core subunits
     20016 (Polr1c)
  RNA polymerase I system
   RNA polymerase I
     20016 (Polr1c)
SSDB
Motif
Pfam: RNA_pol_A_bac RNA_pol_L
Other DBs
NCBI-GeneID: 20016
NCBI-ProteinID: NP_033111
MGI: 103288
Ensembl: ENSMUSG00000067148
Vega: OTTMUSG00000028872
UniProt: P52432
Position
17; 17 C
AA seq 346 aa
MAAAQAVEEMRTRVVLGEFGVRNVHTTDFPGNYAGYDDAWDQNRFEKNFRVDVVQMDEDT
LEFDMVGIDAAIANAFRRILLAEVPTMAVEKVLVYNNTSIVQDEILAHRLGLIPILADPR
LFEYRNQGEEEGTEIDTLQFRLQVRCTRNPNAAKDSSDPNELYVNHKVYTRHMTWVPLGN
QADVFPEGTIRPVHDDILIAQLRPGQEIDLMMHCVKGIGKDHAKFSPVATASYRLLPAIT
LLEPVEGEAAEELSQCFSPGVIEVEEVQGKKVARVANARLDTFSREIFRHEKLKKAVRLA
RVRDHYIFSVESTGVLPPDVLVSEAIKILMGKCRRFLDELDAVEMD
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggcggcggctcaggcggtggaggagatgcggactcgcgtggttctcggagagtttggg
gttcgcaatgtccacaccacggactttcccggtaactacgccggttatgatgatgcctgg
gaccagaaccgcttcgagaagaatttccgtgtggacgtggtgcaaatggatgaagacacg
ctggagttcgacatggtggggattgatgctgccatcgccaatgctttccggagaatcctg
ttagctgaggtgccgacaatggccgtggagaaggtcttggtgtataacaacacgtccata
gtccaggatgagatccttgctcaccgcctggggctcatccccatcctcgctgatcctcgt
ctctttgaatatcggaaccaaggagaggaggaaggaacagagatagacacgctgcagttc
cggctgcaggtcaggtgtaccaggaaccccaatgctgccaaggattcctcagaccccaat
gaactctatgtcaaccataaagtctacaccaggcatatgacatgggtccccttgggaaat
caggctgatgtcttcccagagggcacaatccgtccagtgcacgacgacatcctcatcgct
cagcttcggcctggccaggaaattgacttgatgatgcattgcgtcaagggcattggcaaa
gaccatgccaagttctcaccagtggccacagccagctacagactgctaccggccatcact
ctgcttgagcctgtggaaggagaagcggctgaggagctgagccagtgtttctcccctggc
gtgattgaggtggaggaagtacaaggtaaaaaggtggccagggtggccaatgctcggctg
gataccttcagcagggaaatcttccggcatgagaaactcaagaaggctgtgcggcttgcc
cgggttcgggaccattatatcttttctgtggagtctactggagttttgccaccagatgtg
ttggtgagtgaagccatcaagatcctgatggggaagtgccggcggttcttggatgaactg
gatgcagttgagatggactga

DBGET integrated database retrieval system