KEGG   Mus musculus (mouse): 20017Help
Entry
20017             CDS       T01002                                 

Gene name
Polr1b, 128kDa, D630020H17Rik, RPA116, RPA135, RPA2, Rpo1-2
Definition
(RefSeq) polymerase (RNA) I polypeptide B
  KO
K03002  DNA-directed RNA polymerase I subunit RPA2 [EC:2.7.7.6]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    20017 (Polr1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    20017 (Polr1b)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     20017 (Polr1b)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Core subunits
     20017 (Polr1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol_Rpb2_6 RNA_pol_Rpb2_1 RNA_pol_Rpb2_3 RNA_pol_Rpb2_7 RNA_pol_Rpa2_4 RNA_pol_Rpb2_2 DUF1186
Motif
Other DBs
NCBI-GeneID: 20017
NCBI-ProteinID: NP_033112
MGI: 108014
Ensembl: ENSMUSG00000027395
Vega: OTTMUSG00000015413
UniProt: P70700
Position
2; 2 F1
AA seq 1135 aa AA seqDB search
MDVDGRWRNLPSGPSLKHLTDPSYGIPPEQQKAALQDLTRAHVDSFNYAALEGLSHAVQA
IPPFEFAFKDERISLTIVDAVISPPSVPKGTICKDLNVYPAECRGRKSTYRGRLTADISW
AVNGVPKGIIKQFLGYVPIMVKSKLCNLYNLPPRVLIEHHEEAEEMGGYFIINGIEKVIR
MLIVPRRNFPIAMVRPKWKSRGLGYTQFGVSMRCVREEHSAVNMNLHYVENGTVMLNFIY
RKELFFLPLGFALKALVSFSDYQIFQELIKGKEEDSFFRNSVSQMLRIVIEEGCHSQKQV
LNYLGECFRVKLSLPDWYPNVEAAEFLLNQCICIHLQSNTDKFYLLCLMTRKLFALARGE
CMDDNPDSLVNQEVLSPGQLFLMFLKEKMENWLVSIKIVLDKRAQKANVSINNENLMKIF
SMGTELTRPFEYLLATGNLRSKTGLGFLQDSGLCVVADKLNFLRYLSHFRCVHRGAAFAK
MRTTTVRRLLPESWGFLCPVHTPDGAPCGLLNHLTAVCEVVTKFVYTASIPALLCGLGVT
PVDTAPCRPYSDCYPVLLDGVMVGWVDKDLAPEVADTLRRFKVLREKRIPPWMEVALIPM
TGKPSLYPGLFLFTTPCRLVRPVQNLELGREELIGTMEQLFMNVAIFEDEVFGGISTHQE
LFPHSLLSVIANFIPFSDHNQSPRNMYQCQMGKQTMGFPLLTYQNRSDNKLYRLQTPQSP
LVRPCMYDFYDMDNYPIGTNAIVAVISYTGYDMEDAMIVNKASWERGFAHGSVYKSEFID
LSEKFKQGEDNLVFGVKPGDPRVMQKLDDDGLPFIGAKLEYGDPYYSYLNLNTGEGFVVY
YKSKENCVVDNIKVCSNDMGSGKFKCICITVRIPRNPTIGDKFASRHGQKGILSRLWPAE
DMPFTESGMMPDILFNPHGFPSRMTIGMLIESMAGKSAALHGLCHDATPFIFSEENSALE
YFGEMLKAAGYNFYGTERLYSGISGMELEADIFIGVVYYQRLRHMVSDKFQVRTTGARDK
VTNQPLGGRNVQGGIRFGEMERDALLAHGTSFLLHDRLFNCSDRSVAHMCVECGSLLSPL
LEKPPPSWSAMRNRKYNCTVCGRSDTIDTVSVPYVFRYFVAELAAMNIKVKLDVI
NT seq 3408 nt NT seq  +upstreamnt  +downstreamnt
atggatgtcgacggccggtggcggaacctgcccagcgggcccagcctaaagcatttaacc
gacccctcgtacgggattcccccagagcagcaaaaggcagctttgcaggacctgacgcgg
gcgcacgtggactccttcaactacgcggcgctggaggggctgagccacgcggtgcaggcc
atacctccctttgaatttgctttcaaagatgagcgcatatctcttaccattgtggatgct
gtcatcagtccaccctcagtgcccaaagggaccatctgcaaagatctcaacgtttatcca
gctgagtgtcgtggccgaaagagcacctaccgagggaggctgacggctgatatcagctgg
gccgtgaatggagtccccaaagggatcattaaacagtttctcggctatgttcccatcatg
gtgaagtccaagctttgcaacttatacaaccttcctcctcgagtcctcattgagcaccat
gaggaggcagaggaaatgggcggttattttataatcaatggcatagaaaaagtcatccgc
atgttgattgtgccccggagaaatttccccatcgccatggtaaggccgaaatggaaaagc
agaggactcggctacactcagtttggggtctccatgcgctgtgtgagagaagagcactcc
gccgtgaacatgaacctgcactatgtggagaacggcacggttatgttaaactttatttac
cgcaaagagctctttttccttcctttgggatttgcacttaaggcactcgtgagcttttct
gattatcagattttccaggagcttatcaagggcaaagaggaggactctttctttaggaat
tctgtttctcagatgctgcggattgtcatagaagagggctgtcactcacagaagcaggtt
cttaactatctgggagaatgcttccgagtgaagctcagccttcctgattggtaccctaac
gtggaagctgccgagttcctgcttaaccagtgcatctgcatccacctgcagtccaacact
gacaagttctacctgctctgcctcatgacccggaagctgttcgctttagccagaggggag
tgcatggacgacaaccctgatagcctagtgaaccaagaggtcctcagccctgggcagctc
ttcctgatgtttctgaaggaaaaaatggaaaactggctagtgtctattaaaatagtttta
gataagagggctcagaaggccaatgtttccataaacaacgaaaatttgatgaagattttt
agtatgggaacagagctaacaagaccatttgaatatcttcttgctactgggaatctgcgt
tctaaaacaggtctcggcttcctgcaagattctggcctgtgtgttgtggctgacaagctg
aacttccttcgctacctctcccatttccgctgtgtgcacagaggggctgcctttgccaag
atgaggaccaccaccgtgcgcaggctgctgccagaatcctggggcttcctctgccctgtg
cacactccagacggggcgccttgtgggctgttgaaccacttgactgccgtgtgtgaggtt
gttaccaagtttgtgtacacggcatctattccagccttgctctgtggcttaggagtcact
cctgttgatacagcgccatgtcgaccgtacagtgactgctaccctgtcctgctggatggc
gtcatggtgggctgggtggataaggaccttgctcctgaagttgcagacactctccgtcga
ttcaaggtgttgagagaaaaaagaattcctccctggatggaggtggccctgattcccatg
acaggaaaaccaagtctgtacccaggtctgttcctctttaccactccctgcaggctggtg
aggcctgtgcagaacttggaactgggcagagaagagctcattggaaccatggaacagctc
ttcatgaacgtcgccatctttgaggacgaggtgtttggtggcatctccacacaccaggag
ctcttccctcacagcctgctgagcgtgatcgccaacttcatccccttctcggatcacaac
cagagtcctcggaacatgtaccagtgccagatgggtaagcagaccatgggctttccgctg
ctcacttaccaaaaccgatcagataataaactctatcgactccaaacccctcagagccct
ctagtgagaccgtgcatgtatgatttctatgacatggacaactatccgatcgggacaaac
gccattgtagctgtgatctcctacactggctatgatatggaggacgccatgattgtcaac
aaggcttcctgggaacgaggcttcgctcatggaagcgtctacaagtctgagttcatagac
ctctcagagaagtttaagcagggagaggataacctggtgttcggggtcaagcctggtgac
cctcgggtgatgcagaagctggacgatgatgggttgccattcataggcgcaaagctggag
tatggcgacccttactacagctacctcaaccttaacactggggaaggcttcgtggtttac
tacaagagtaaagaaaactgtgttgtggacaacatcaaagtgtgtagtaacgacatgggc
agtgggaagttcaagtgtatctgcatcacagtccgcatcccccggaacccaaccattgga
gataagtttgccagccgacatggtcagaagggcattttgagcagattgtggccagccgag
gacatgcctttcactgagagtggcatgatgccggacattctgtttaatcctcacgggttt
ccctcccgtatgaccataggtatgttaatcgagagcatggctgggaagtctgcagctttg
cacggtctctgccatgatgctacacccttcatcttctccgaggagaactctgccttagag
tactttggtgagatgttaaaggctgctggctacaacttctacggcaccgagagactgtat
agtggcatcagtgggatggagctggaggctgacatcttcattggtgtggtttattaccag
cgcttacgacacatggtgtcagacaaatttcaagtcagaacaactggagccagggacaaa
gtcaccaaccagcccctcgggggacgaaatgttcagggtggaatccgctttggggagatg
gagcgggatgctctgttggcacacggtacgtctttccttcttcatgaccggcttttcaac
tgctctgaccgttctgtcgctcacatgtgtgtagagtgtggcagtttgctttctccgcta
cttgagaagcctcctccgtcttggtctgcgatgcgcaacagaaagtacaactgcactgtc
tgtggccgcagtgacaccatcgacaccgtctctgtgccgtatgtcttccggtactttgta
gctgagctggcagccatgaacatcaaagtgaaactggatgtcatctga

DBGET integrated database retrieval system