KEGG   Mus musculus (mouse): 20018
Entry
20018             CDS       T01002                                 

Gene name
Polr1d, 1110003G10Rik, 16kD, AC19, RPA16, Rpo, Rpo1-3, mRP
Definition
(RefSeq) polymerase (RNA) I polypeptide D
  KO
K03020  DNA-directed RNA polymerases I and III subunit RPAC2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
mmu04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    20018 (Polr1d)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    20018 (Polr1d)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    20018 (Polr1d)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Core subunits
     20018 (Polr1d)
  RNA polymerase I system
   RNA polymerase I
     20018 (Polr1d)
SSDB
Motif
Pfam: RNA_pol_L_2 RNA_pol_L
Other DBs
NCBI-GeneID: 20018
NCBI-ProteinID: NP_033113
MGI: 108403
Ensembl: ENSMUSG00000029642
Vega: OTTMUSG00000024630
UniProt: P97304 Q545W2
Position
5; 5 G3
AA seq 133 aa
MEDDQELERKISGLKTSMAEGERKTALEMVQAAGTDRQCVTFVLHEEDHTLGNCLRYIIM
KNPEVEFCGYTTTHPSESKINLRIQTRGALPAVEPFQKGLNELLNVCQHVLVKFEASIKD
YKAKKASKKEPTF
NT seq 402 nt   +upstreamnt  +downstreamnt
atggaagacgatcaggagctggagagaaaaatatcaggattgaagacctcaatggctgaa
ggcgagaggaagacagccctggaaatggtccaggcagctggaacagatagacagtgtgtg
acatttgtcctgcacgaggaggaccatacactaggaaactgtctgcggtacataatcatg
aagaacccggaagtggaattttgtggttacactacgacccatccttcagagagcaaaatt
aatttgcgaattcagacccggggtgcccttccagctgttgagccgtttcagaaaggcctg
aatgagctcttgaatgtctgccagcatgtgcttgtcaagtttgaggccagcataaaggac
tataaagctaaaaaggcaagcaaaaaggagcccacattctag

DBGET integrated database retrieval system