KEGG   Mus musculus (mouse): 20019
Entry
20019             CDS       T01002                                 

Gene name
Polr1a, 194kD, 194kDa, 2900087K15Rik, 3010014K16Rik, RPA, RPA194, Rpo, Rpo1-4, mR, mRPA1
Definition
(RefSeq) polymerase (RNA) I polypeptide A
  KO
K02999  DNA-directed RNA polymerase I subunit RPA1 [EC:2.7.7.6]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    20019 (Polr1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    20019 (Polr1a)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     20019 (Polr1a)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Core subunits
     20019 (Polr1a)
SSDB
Motif
Pfam: RNA_pol_Rpb1_5 RNA_pol_Rpb1_2 RNA_pol_Rpb1_3 RNA_pol_Rpb1_4 RNA_pol_Rpb1_1
Other DBs
NCBI-GeneID: 20019
NCBI-ProteinID: NP_033114
MGI: 1096397
Ensembl: ENSMUSG00000049553
Vega: OTTMUSG00000057916
UniProt: O35134 Q3UHI3 Q3TU49
Position
6 C1; 6 32.21 cM
AA seq 1717 aa
MLASKHTPWRRLQGISFGMYSAEELKKLSVKSITNPRYVDYLGNPSANGLYDLALGPADS
KEVCATCVQDFNNCSGHLGHIDLPLTVYNPFLFDKLYLLLRGSCLSCHMLTCPRAAIYLL
ISQLRVLEVGALQAVYELERILSRFLEETGDPSAFEIQEELEEYTSKILQNNLLGSQGTH
VKNVCESRSKLVAQFWKTHMAAKQCPHCKTGRSVVRKEHNSKLIITYPATVHKKSDQEGT
ELPEGVPEAPGIDKAQMGKRGYLTPSSAQEHLFAIWKNEGFFLNYLFSGLDDIGPESSFN
PSMFFLDFIVVPPSRYRPVNRLGDQMFTNGQTVNLQAVMKDAVLIRKLLALMAQEQKLPC
EMTELTIDKENDSSVAIDRSFLGLLPGPSLTDKLYNIWIRLQSHVNIVFDSEMDKLMLEK
YPGIRQILEKKEGLFRKHMMGKRVDYAARSVICPDMYINTNEIGIPMVFATKLTYPQPVT
PWNVQELRQAVINGPNVHPGASMVINEDGSRTALSSVDAAQREAVAKQLLTPATGAPKPQ
GTKVVCRHVKNGDILLLNRQPTLHRPSIQAHRARILPEEKVLRLHYANCKAYNADFDGDE
MNAHFPQSELGRAEAYVLACTDQQYLVPKDGQPLAGLIQDHMVSGANMTIRGCFFTREQY
MELVYRGLTDKVGRVKLFPPAILKPFPLWTGKQVVSTLLINIIPEDYAPLNLSGKAKIGS
KAWVKEKPRPIPDFDPDSMCESQVIIREGELLCGVLDKAHYGSSAYGLVHCCYEIYGGET
SGRVLTCLARLFTAYLQLYRGFTLGVEDILVKPNADVVRQRIIEESTQCGPQAVKAALSL
PETASCDEIQGKWQDAHLSKDQRDFNMIDMKFKEEVNHYSNEINKACMPLGLHRQFPENN
LQMMVQSGAKGSTVNTMQISCLLGQIELEGRRPPLMASGKSLPCFEPYEFTPRAGGFVTG
RFLTGIRPPEFFFHCMAGREGLVDTAVKTSRSGYLQRCIIKHLEGLVIQYDLTVRDSDGS
VVQFLYGEDGLDIPKTQFLQPKQFPFLAGNYEVIMKSKHLHEVLSRADPQKVLGHIKAIK
KWHHKHSGALLRKGAFLSFSQKIQAAVKALNLKGSIQNGRSPETQQMLQMWYDLDEESRW
KYQKRAAPCPDPSLSVWRPDIYFASVSETFEKKIDDFSQEWAAQAERSYKKSELSLDRLR
TLLQLKWQRSLCDPGEAVGLLAAQSIGEPSTQMTLNTFHFAGRGEMNVTLGIPRLREILM
VASANIKTPMMSVPVFDTKKALKKVKSLKKRLTRVCLGEVLQKVDIQESFCMGEKRNKFQ
VYELRFQFLPHAYYQQEKCLRPEDILHFMETRFFKLLMEAIKKKKNKASAFRNVNSRRAT
QKDLNDTEDSGRSQREEERDEEEEGNIVDAEAEEGDADASDTKRKEKQEEEVDYESEEEG
EEEEEEEVQEEGNIKGDGVHQGHEPDEEEHLGLEEEESSQKPPRRHSRPQGAEAIKRRIQ
AVRESYSFIEDYQYDTEESLWCQVTVKLPLMKINFDMSSLVVSLAHKAIVYTTKGITRCL
LNETTNSKNEKELVLNTEGINLPELFKYSEILDLRRLYSNDIHAMANTYGIEAALRVIEK
EIKDVFAVYGIAVDPRHLSLVADYMCFEGVYKPLNRFGIQSSSSPLQQMTFETSFQFLKQ
ATMMGSHDELKSPSACLVVGKVVKGGTGLFELKQPLR
NT seq 5154 nt   +upstreamnt  +downstreamnt
atgctggcctccaagcacacaccatggaggcggcttcagggcatttccttcggaatgtat
tcggccgaagagctcaagaagttaagtgttaaatccattacaaatcctcgatacgtggac
tacctgggaaacccttcagcaaatggcctgtatgatttggctttgggtcctgcagattcc
aaagaagtatgcgctacctgcgtgcaggacttcaacaactgctctggacacctgggccac
attgatctcccgctcacagtctacaaccctttcctctttgataaactctacctgctgctt
cgaggctcctgtttgagttgccacatgctgacttgtcctcgggctgcaatttacctgttg
atctcccagctgagggtcctggaagttggagccctgcaagcagtctacgagcttgagcga
attctcagcaggtttctggaagaaactggagatccttccgccttcgaaattcaagaagag
ttagaagaatacacaagcaaaattctgcagaacaacctcttggggtcccagggcacacat
gtgaaaaatgtgtgcgagagcagaagcaaacttgtcgctcagttctggaagacacacatg
gctgcgaagcagtgtccacactgcaagacgggacggtcggtggttcgaaaggagcacaat
agtaaactaatcatcacatacccagccacggtgcacaagaaatcagaccaggagggcaca
gaactcccagaaggagtgccggaagctccaggaattgacaaggctcagatggggaaacga
gggtacctgaccccaagcagcgcccaagaacaccttttcgccatttggaagaatgaagga
ttctttctgaattatcttttttcgggattggatgatattggcccagagtccagtttcaac
cccagtatgttctttctagacttcatagtcgtaccgccatccaggtaccgtcccgtcaat
cgcctgggtgaccagatgttcactaatggccagacagtaaacttgcaagctgtcatgaag
gatgcagttttgatccggaaacttctggcgttgatggcccaagaacagaaactgccctgt
gagatgacagaactcaccatagacaaggaaaatgactcctcagtggctatcgaccgatcc
ttcctgggtttgcttccaggcccgtctctcacagataaactttacaacatttggattcgc
cttcagagccacgtcaatattgtgtttgacagtgagatggacaaattgatgttggaaaag
taccctggcataagacagatcctagagaagaaggaaggcctgttccggaagcacatgatg
ggaaagcgagttgactacgcagcccgctcggtcatctgcccagacatgtacatcaacacc
aatgagatcggaatccccatggtatttgccacaaaactgacttaccctcagccagttacc
ccctggaacgtgcaggaactgagacaggcagtcatcaatggacccaatgtgcacccagga
gcctccatggtcatcaacgaggatggcagtcgcacagccctgagctcagtggatgctgcg
cagcgggaagctgtggccaaacagctcctgacaccagccacaggggctccgaagcctcag
gggacaaaagttgtgtgccggcatgtgaaaaatggggacatcctcctcctgaaccgacag
cctaccttgcacagaccctccatccaggcccaccgtgcccgcattctgcctgaagaaaaa
gtcctacgccttcactatgccaactgcaaggcctacaatgctgactttgatggagatgag
atgaacgcccacttcccccagagtgagttgggccgagctgaagcctatgtcctggcctgc
actgatcagcagtatcttgttcccaaggatggccagccattggcaggactgatccaagat
cacatggtttcaggtgcaaacatgaccattcggggatgctttttcacccgggaacagtac
atggaactggtgtaccgagggctcacagacaaagtgggacgcgtgaagctctttcctccc
gccatcctgaagcccttcccactgtggacaggaaaacaggttgtgtcgaccctcctcata
aacataattccagaggactacgcccccctgaacttatctggaaaggcaaaaattggcagc
aaagcctgggtgaaggaaaagccacggcctatccctgactttgacccggactccatgtgt
gagtcccaggtgatcatcagggaaggagagctgctctgcggagtgctggacaaggcacac
tatgggagctctgcctacggcctggtccactgctgctatgagatctatgggggtgagacc
agcggcagggttctcacctgcctagcccgcctcttcactgcctacctccagctctataga
ggtttcaccttgggtgtagaagacattttggttaagccaaatgcagatgtggtgagacag
cgtatcattgaagaatctacccagtgtggaccccaggctgtcaaggctgcattgagcctg
ccagaaactgcatcatgtgatgaaatccaagggaaatggcaggatgcccatctgagcaaa
gaccagagggattttaacatgattgatatgaagttcaaggaggaagtgaaccattacagc
aatgagattaacaaggcatgtatgcctcttggcttgcacagacagttccccgaaaacaac
ctgcagatgatggtgcagtcaggagccaaagggtcaaccgtgaacacgatgcaaatctct
tgcctgctgggccaaattgaattggaaggtcggagacccccactgatggcgtctggcaag
tcactgccctgctttgagccttacgagttcacccccagggctggtggctttgtcactgga
aggtttcttaccggtatcaggcctcctgagttcttcttccactgcatggcaggacgagaa
ggcctggtggacactgctgtcaaaaccagccgttctggctatctccaaaggtgtatcatc
aagcacctggaggggctggtcatccagtacgatctgacggtccgtgacagcgatggcagc
gtggtccagttcctgtatggggaggacggcctggacatccccaagacacagttcctacag
cccaagcagttcccctttctggccggcaattatgaggtgataatgaaatccaagcatctt
catgaagttttatccagagcagatccccagaaagtgctcggccacatcaaagccattaaa
aaatggcatcacaagcattccggtgccctgctgaggaaaggcgccttcctcagtttttcc
cagaagatccaggcagctgtgaaagctttgaacctaaagggcagtatccagaatggccgc
agccccgagacccagcagatgttacagatgtggtatgacttggatgaagagagccgatgg
aaataccagaagagggctgccccttgtcccgaccctagcctttctgtgtggcgcccagac
atctactttgcatctgtgtctgaaacatttgaaaagaagattgatgacttcagtcaggaa
tgggcagctcaagcagagaggagttacaagaaatcagagctttccctcgacaggctgaga
accttactgcagctgaagtggcagcgctcactgtgtgacccaggcgaggctgttggcctc
ctggctgcccagagcatcggagagccctccacacagatgacactgaacaccttccacttt
gcaggcagaggcgagatgaacgtcaccctgggcattccaagattgagggagattctcatg
gtggccagtgccaacatcaaaacgcccatgatgagtgtgcctgtgttcgacaccaagaaa
gcattgaagaaagtgaagagtctaaagaagaggctcaccagagtgtgcctgggggaggta
ttgcagaaagttgacatccaggagtccttctgtatgggagaaaaacggaataagttccag
gtgtatgagctccggtttcagttcctgccacatgcatattaccagcaggagaagtgcctg
agacccgaggacatcttgcacttcatggaaaccagattctttaagctactaatggaagct
atcaaaaagaagaaaaacaaagcatcagccttcagaaatgtgaattcgaggagagctaca
cagaaggacctcaatgacactgaggactcggggaggagtcagagagaggaggaaagggat
gaggaagaggaggggaacattgtggatgctgaagctgaggagggcgatgcagacgcttct
gacaccaaacgcaaggagaagcaagaagaagaggttgactatgagagtgaggaagaagga
gaggaggaagaggaggaggaggtacaagaagaagggaacatcaaaggcgacggtgtccac
cagggccatgagccagatgaggaagaacatttaggcctcgaggaggaggagtcatcccag
aagcctccccgccgccactccaggcctcagggagctgaggccataaaacgccggatccag
gctgtacgggagtcctactcgttcatcgaggactaccagtatgacacagaggagagcctg
tggtgtcaggtgactgtgaagctcccactgatgaagattaattttgacatgagctccttg
gttgtgtccttggcccacaaagccattgtctatacgaccaagggcatcactcggtgcctc
ctgaacgaaacgaccaacagtaagaatgagaaggagcttgtactgaacacggagggaatc
aaccttcccgagctgttcaagtactccgagatactggacctgcgccgcctctactccaat
gacatccacgccatggccaatacttatggcatcgaggctgcgttgcgggtgatagagaag
gagattaaagatgtgtttgctgtgtatggcattgcagttgatcctcgccatctctccctg
gtggctgattacatgtgttttgagggggtttataagccactcaatcgctttgggatccag
tcaagctcctcccctttgcagcagatgacatttgaaaccagcttccagtttctgaaacag
gccaccatgatgggatcccatgatgaactcaagtcaccttccgcctgcctcgtggtggga
aaggttgtcaaaggcgggacaggcctgtttgagctcaagcagcccctaagatag

DBGET integrated database retrieval system