KEGG   Mus musculus (mouse): 20020
Entry
20020             CDS       T01002                                 

Gene name
Polr2a, 220kD, 220kDa, Rpb1, Rpo, Rpo2-1
Definition
(RefSeq) polymerase (RNA) II (DNA directed) polypeptide A
  KO
K03006  DNA-directed RNA polymerase II subunit RPB1 [EC:2.7.7.6]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    20020 (Polr2a)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    20020 (Polr2a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    20020 (Polr2a)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    20020 (Polr2a)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     20020 (Polr2a)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     20020 (Polr2a)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      20020 (Polr2a)
SSDB
Motif
Pfam: RNA_pol_Rpb1_1 RNA_pol_Rpb1_5 RNA_pol_Rpb1_2 RNA_pol_Rpb1_6 RNA_pol_Rpb1_7 RNA_pol_Rpb1_3 RNA_pol_Rpb1_4 RNA_pol_Rpb1_R
Other DBs
NCBI-GeneID: 20020
NCBI-ProteinID: NP_001277997
MGI: 98086
Ensembl: ENSMUSG00000005198
Vega: OTTMUSG00000006003
UniProt: P08775
Position
11 B3; 11 42.86 cM
AA seq 1970 aa
MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDP
RQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVD
SNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKG
HGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEP
RYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAA
HVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVD
FSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYII
RDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWS
TFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQD
TLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHI
NCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEM
GHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKA
HNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKIN
ISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHA
MGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGES
VEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMR
EDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKL
VIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAI
AHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLT
VFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMP
DFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIR
IMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKI
IITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALER
ELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLM
EAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGLGAAGPTG
MFFGSAPSPMGGISPAMTPWNQGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPG
YSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPAYEPRSPGGYTPQSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPS
YSPTSPNYSPTSPNYTPTSPSYSPTSPSYSPTSPNYTPTSPNYSPTSPSYSPTSPSYSPT
SPSYSPSSPRYTPQSPTYTPSSPSYSPSSPSYSPTSPKYTPTSPSYSPSSPEYTPASPKY
SPTSPKYSPTSPKYSPTSPTYSPTTPKYSPTSPTYSPTSPVYTPTSPKYSPTSPTYSPTS
PKYSPTSPTYSPTSPKGSTYSPTSPGYSPTSPTYSLTSPAISPDDSDEEN
NT seq 5913 nt   +upstreamnt  +downstreamnt
atgcacgggggtggccccccctccggggacagcgcatgcccgctgcgcaccatcaagaga
gtgcagttcggagtcctgagtccggatgaattgaagcggatgtctgtgacagagggtggt
atcaaatacccagaaacaacggagggaggtcgccccaaacttgggggactaatggatcca
cggcagggggtgattgagcggactggccgctgccaaacatgtgcaggaaacatgaccgag
tgtcctggccactttggccacatcgaattggccaaacctgtgtttcatgtgggcttcctg
gtgaagacaatgaaggttttgcgctgtgtctgcttcttctgctccaaactgcttgtagat
tctaataacccgaagattaaggacatcctggccaaatctaaggggcagccaaagaaacgg
cttacgcatgtctatgacctgtgcaagggcaaaaacatctgtgaaggtggagaggagatg
gacaacaagtttggtgtggagcagccggagggtgatgaggatctgaccaaagagaagggc
catggcggctgtgggcggtaccaaccccgaatccggcgctctggcctagagttgtatgct
gaatggaagcatgttaatgaggactctcaggagaaaaagatcttgctgagtccagaacga
gtgcatgaaatcttcaaacgcatctcagatgaggagtgttttgtgttgggcatggagcct
cgctatgcccggcctgagtggatgattgtcacagtgttgcctgtgcctcctctctcagtg
agacctgctgtggtgatgcagggttctgctcgaaaccaggatgatctgactcacaaactg
gctgacattgtgaagatcaacaatcagctgcggcggaacgagcagaatggtgcagctgcc
catgtcatagcagaagatgtaaaacttctccagttccatgtggccaccatggtggacaat
gaactgcccggcttaccccgtgccatgcagaagtctggccgtcccctcaagtccctgaag
caacggttgaagggcaaagaaggacgggttcgagggaatctaatgggcaagcgagtggac
ttctcagcccgcactgtcatcacccctgaccctaacctatccattgaccaagtgggtgtg
ccccgctccattgctgccaacatgacctttgcagagattgtcacacccttcaatattgac
agacttcaggaattagtacgcaggggaaacagccagtatccaggagccaagtacatcatc
cgcgataatggcgatcgaattgacttgcgtttccatcctaagcccagtgaccttcatctg
cagactggctataaggtggaacggcacatgtgtgatggggacattgttatcttcaatcgt
cagccaactttgcacaaaatgtccatgatggggcatcgggtccgaatcctcccctggtct
acttttcggttgaatcttagtgtgacaactccatacaatgcagactttgatggagatgag
atgaatttgcatctgccacagtctctggaaacacgggcagagatccaagagttggctatg
gtgcctcgaatgattgtcaccccccagagcaatcgacctgtcatgggtattgtgcaagac
acactcacggcagtacgcaaattcactaagagagatgtcttcctggagcggggtgaagtc
atgaacctcttaatgtttctgtccacgtgggatggcaaggtcccacaaccagctatcctc
aagccccggcccctgtggacaggcaagcagatcttctccctcatcatacctggacacatc
aattgtatccgtacccacagcacccatcctgatgatgaagatagtggcccttacaagcac
atctctcctggggacaccaaagttgtagtggagaatggggagcttatcatgggcatcctt
tgtaagaagtccctgggcacctcagcaggctcgctggtccatatctcctacctggagatg
gggcatgacatcacccgcctcttctactccaacattcagactgtcattaacaactggctt
ctcatcgagggtcataccattggcattggggactccattgcagattcaaagacttaccag
gacattcagaacactattaagaaagctaaacaagatgtaatagaggtcattgagaaggct
cataacaatgagctagaacccactccaggaaacacattgcgtcagacatttgagaatcaa
gtgaatcgtattctcaatgatgctcgagacaaaactggctcctctgcacagaaatccctc
tctgaatataacaacttcaagtctatggtggtgtctggagccaagggttccaagatcaac
atctcccaggtcattgctgttgtcgggcagcagaatgtagagggcaagcggatcccattt
ggattcaagcatcggactcttcctcactttatcaaggatgattatggtcctgagagccga
ggctttgtagaaaattcatacttggctggtctcacacccactgagttcttcttccatgcc
atgggaggacgagaaggtctcattgacacggctgttaagactgctgagactgggtatatt
cagcgaaggctgataaagtccatggagtcggtgatggtgaaatatgatgcaactgtgagg
aactccatcaaccaggtggtacagctgcgctatggagaggacggcctggcaggggagagt
gttgagttccagaatctggctacacttaaaccttctaataaagcttttgagaagaagttc
cgttttgattataccaatgagagggccctgcggcgcacccttcaggaggacctggtaaag
gatgtgctgagcaatgcccatatacagaatgagctggaacgggaatttgaacggatgcgt
gaagatcgggaagtgctcagggtcatcttcccaactggtgacagcaaggtggtcctccct
tgtaaccttctgcggatgatctggaatgctcagaaaatcttccacatcaaccctcgcctt
ccctctgacctgcatcccatcaaagtggtagagggagtcaaagaattgagcaagaagttg
gtaattgtgaatggagatgacccactaagtcggcaggcacaggagaatgccacattgctc
ttcaacatccacctaagatccacactctgctctcgccgcatggctgaggagtttcggctg
agtggagaggcctttgactggctgcttggggagatagagtccaagttcaaccaagccatt
gcccatcctggagaaatggtgggagctctggctgctcagtctcttggagaacctgccact
cagatgaccctgaacactttccactatgctggtgtatctgccaagaatgtgacgctgggt
gtgcctcgacttaaggagcttatcaacatttccaagaagccaaagactccttcactcact
gtcttcctgttaggtcaatctgcacgagatgctgaaagagccaaggacattctttgccgc
ttggaacatacaacattgaggaaggtgactgccaatacagccatctactatgaccctaac
ccccagagcacagtggtggcagaagatcaggagtgggtgaatgtgtactatgagatgccc
gactttgacgtggcccggatatctccctggctgctgcgtgtggagctcgaccgaaagcac
atgactgaccggaagcttaccatggaacagattgctgagaaaatcaatgcaggttttggc
gatgatttgaattgtatcttcaacgatgataatgcagagaagctggtccttcgaatccgc
atcatgaacagtgatgaaaacaagatgcaagaggaggaagaggtggtggataaaatggat
gatgatgtcttcctgcgatgcattgagtccaacatgctgacagatatgaccctgcagggt
atcgagcagatcagcaaggtgtacatgcacttacctcagacagacaacaagaagaagatc
atcatcacagaggatggggagttcaaggccctgcaggaatggatcttagagacggatggt
gtgagcctgatgcgggtgctgagtgagaaggatgtagaccctgtgcgcaccacgtccaat
gatattgtggagatcttcacggtactgggcattgaggctgtgcggaaggctctggagcga
gaactgtaccatgtcatctcctttgatggttcttatgtcaattatcggcatttggcgctc
ctgtgtgacactatgacatgccgtggccacttgatggccatcactcgtcatggggtcaac
cgccaggacactggaccgctcatgaaatgctcctttgaggaaacggtggatgtccttatg
gaagcagcagcacatggggagagtgacccgatgaagggagtctctgagaatattatgctg
ggccagctcgctccagctggtactggctgttttgacctcctgcttgatgctgagaagtgc
aaatacggcatggaaatccccaccaatatccctggcctgggggctgctggacctaccggc
atgttctttggctctgcacccagtccgatgggaggaatatctcctgcaatgacaccctgg
aaccagggtgcaactcccgcctatggtgcctggtccccgagtgttgggagcgggatgacc
ccaggagcggccggcttctctcccagtgctgcatctgatgccagtggcttcagcccaggt
tactcccctgcatggtctcccacaccaggctctccgggctcccctggaccctcaagccca
tacatcccctcaccaggtggtgctatgtctcccagctactcaccgacatcaccagcctat
gagccacgctcccctgggggctatacaccccagagcccctcctactcccctacttcacct
tcctactccccaacctctccatcttactctccaaccagtcccaactacagccctacctct
cctagctactcgcccacctcccctagctactcgccaacctctccttcctactcccccacc
tctccaagctattccccaacctctcctagctactccccaacctctccaagctattctcca
acatcacctagctattctccaacttctcccagctactcaccgacatctcctagctactcc
ccaacttctcccagctactcaccaacttcaccaagctattctcccacctcccccagctac
tcaccgacatctcccagctactcaccaacttctccaagctactcaccaacttctccaagc
tactcacccaccagccctaactattctccaactagtcccaactataccccgacatcaccc
agctacagcccaacctcacccagttactcacctacaagtcccaactatacacccaccagc
cctaattacagcccaacctctccaagctattccccaacctcacccagttattcccccacc
tcaccaagctactccccctccagcccacgatatacaccacagtctccaacctacacacca
agctcaccaagctacagtcccagctcaccaagctacagccccacttcacccaagtacacc
ccaactagtccttcctacagtcccagctcaccagagtacaccccagcttctcccaaatac
tcacctacaagccctaaatattcacccacttctcccaagtattctcctaccagccccact
tactcacctaccaccccaaaatattctccaacctccccgacatactcaccaacctctcca
gtctataccccgacctctcccaagtactccccaaccagccctacctactcgcccacttct
cccaagtactcgcccaccagtcccacctactcacccacctctcccaagggctccacctac
tctcccacttctcctggctactcacccactagccccacctacagcctcaccagcccagcc
atcagcccagatgacagcgatgaggagaactga

DBGET integrated database retrieval system