KEGG   Mus musculus (mouse): 20021
Entry
20021             CDS       T01002                                 

Gene name
Polr2c, 33kD, 33kDa, RP, RPB3, Rpo, Rpo2-3, mRBP, mRBP31
Definition
(RefSeq) polymerase (RNA) II (DNA directed) polypeptide C
  KO
K03011  DNA-directed RNA polymerase II subunit RPB3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    20021 (Polr2c)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    20021 (Polr2c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    20021 (Polr2c)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    20021 (Polr2c)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     20021 (Polr2c)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      20021 (Polr2c)
SSDB
Motif
Pfam: RNA_pol_A_bac RNA_pol_L
Other DBs
NCBI-GeneID: 20021
NCBI-ProteinID: NP_033116
MGI: 109299
Ensembl: ENSMUSG00000031783
Vega: OTTMUSG00000061706
UniProt: P97760
Position
8; 8 C5
AA seq 275 aa
MPYANQPTVRITELTEENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLH
DEFIAHRLGLIPLTSDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDL
ISNSPRVIPVTSRNRDNDPNDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTA
GVAFEYDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLR
PETIVLSALSGLKKKLSDLQTQLSHEIQSDVLTIN
NT seq 828 nt   +upstreamnt  +downstreamnt
atgccgtacgccaaccagccaacagtgcggatcacggaactcaccgaagagaacgtcaag
ttcattatcgagaacacggacctggcggtggccaattccattcggagggtcttcatcgca
gaggtgcccataatagccatcgactgggttcagattgacgccaactcctcggtccttcat
gatgaattcatcgcgcacaggcttggtttaatccccctcactagtgatgacattgtggac
aagctgcagtactcccgggactgcacatgtgaagagttctgccctgagtgttctgtggag
ttcactctcgatgtgaggtgcaatgaagaccagacgcgccatgtcacctcccgagatctc
atctccaacagcccccgggttattccggtgacatctcggaaccgggataacgaccctaat
gactatgtggagcaggatgacatccttattgtcaagctgaggaaggggcaggagctgaga
cttcgagcctatgccaagaagggctttggcaaggaacatgccaagtggaaccctactgcg
ggggtagcttttgaatacgatccagacaacgcacttaggcatacagtgtatcccaagcct
gaggaatggcccaagagtgagtattccgagctggatgaggatgagtcgcaggctccctac
gaccccaacggcaagccagagaggttttactacaatgtggagtcgtgtggctcactgcgc
cctgaaaccattgtcctctcagccctgtcggggctaaagaagaagctgagtgatttacag
actcagttaagccatgagatccagagtgacgtgctcaccataaactag

DBGET integrated database retrieval system