KEGG   Mus musculus (mouse): 20022
Entry
20022             CDS       T01002                                 

Gene name
Polr2j, 14.5kD, 14.5kDa, Polr2i, Rpb, Rpb11a, Rpo, Rpo2-4
Definition
(RefSeq) polymerase (RNA) II (DNA directed) polypeptide J
  KO
K03008  DNA-directed RNA polymerase II subunit RPB11
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03020  RNA polymerase
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    20022 (Polr2j)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    20022 (Polr2j)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    20022 (Polr2j)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    20022 (Polr2j)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Core subunits
     20022 (Polr2j)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      20022 (Polr2j)
SSDB
Motif
Pfam: RNA_pol_L_2 RNA_pol_L SHNi-TPR
Other DBs
NCBI-GeneID: 20022
NCBI-ProteinID: NP_035423
MGI: 109582
Ensembl: ENSMUSG00000039771
Vega: OTTMUSG00000025440
UniProt: Q6PI63 Q3TYI2
Position
5; 5 G2
AA seq 117 aa
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAG
YKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
NT seq 354 nt   +upstreamnt  +downstreamnt
atgaacgctcctccggccttcgagtcgttcttgctcttcgagggcgagaagaaaatcacc
attaacaaggacactaaggttcccaacgcctgcttgttcaccatcaacaaagaagaccac
actctggggaacatcattaaatcgcagctgttgaaggacccgcaggtgctgtttgctggc
tacaaagtccctcaccccttggagcacaagatcatcattcgtgtgcagaccaccccagac
tacagtccccaggaggctttcaccaacgccatcacagacctcatcagcgagctctccctt
ctggaggagcgattccgggtggccatcaaggacaagcaagaaggaattgagtag

DBGET integrated database retrieval system