KEGG   Mus musculus (mouse): 20024
Entry
20024             CDS       T01002                                 

Gene name
Sub1, AI842364, P15, P9, Pc4, Rpo2tc1
Definition
(RefSeq) SUB1 homolog, transcriptional regulator
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: PC4
Other DBs
NCBI-GeneID: 20024
NCBI-ProteinID: NP_035424
MGI: 104811
Ensembl: ENSMUSG00000022205
Vega: OTTMUSG00000023586
UniProt: P11031
Position
15; 15 A1
AA seq 127 aa
MPKSKELVSSSSSGSDSDSEVEKKLKRKKQAVPEKPVKKQKPGETSRALASSKQSSSSRD
DNMFQIGKMRYVSVRDFKGKILIDIREYWMDSEGEMKPGRKGISLNMEQWSQLKEQISDI
DDAVRKL
NT seq 384 nt   +upstreamnt  +downstreamnt
atgcctaaatcaaaggaacttgtttcttcaagctcttcaggcagtgattcggacagcgaa
gttgaaaaaaagttaaagaggaaaaagcaagcggttccagagaagcccgtgaagaagcag
aagcctggtgagacttctagagcactggcatcctccaagcagagcagcagcagcagagat
gacaacatgttccagattggaaagatgagatatgtcagtgttcgggacttcaaaggaaaa
attctaattgatattagagaatattggatggattcagaaggtgaaatgaaaccaggaaga
aaaggtatttctttaaacatggaacaatggagccagctgaaggaacagatctctgatata
gatgacgcagtaagaaagctgtaa

DBGET integrated database retrieval system