KEGG   Mus musculus (mouse): 20085
Entry
20085             CDS       T01002                                 

Symbol
Rps19, Dsk, Dsk3
Name
(RefSeq) ribosomal protein S19
  KO
K02966  small subunit ribosomal protein S19e
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03010  Ribosome
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    20085 (Rps19)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    20085 (Rps19)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mmu03011]
    20085 (Rps19)
Ribosome [BR:mmu03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    20085 (Rps19)
  Archaea
    20085 (Rps19)
SSDB
Motif
Pfam: Ribosomal_S19e HTH_12 HTH_IclR
Other DBs
NCBI-GeneID: 20085
NCBI-ProteinID: NP_075622
MGI: 1333780
Ensembl: ENSMUSG00000040952
Vega: OTTMUSG00000022935
UniProt: Q9CZX8
Position
7; 7 A3
AA seq 145 aa
MPGVTVKDVNQQEFVRALAAFLKKSGKLKVPEWVDTVKLAKHKELAPYDENWFYTRAAST
ARHLYLRGGAGVGSMTKIYGGRQRNGVRPSHFSRGSKSVARRVLQALEGLKMVEKDQDGG
RKLTPQGQRDLDRIAGQVAAANKKH
NT seq 438 nt   +upstreamnt  +downstreamnt
atgcccggagttactgtaaaagacgttaaccagcaggagttcgtcagagctctggcagcc
ttcctcaaaaagtccgggaagctgaaagtccccgaatgggtggacacagtcaagctggcc
aaacataaagagcttgccccatatgatgagaactggttctacacacgagctgcttccaca
gcacggcacctgtacctccgaggtggtgctggggttggttccatgaccaagatctatgga
ggacggcagagaaacggtgtcagacccagccatttcagcagaggctctaagagtgtggcc
cgccgggtcctccaagccctggaggggctgaaaatggtggaaaaggaccaagatgggggc
cgcaagctgacgcctcagggacagagagacctggacaggatcgctggacaggtggcagct
gccaacaagaagcattag

DBGET integrated database retrieval system